Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; EC 2.3.1.9 (characterized)
to candidate WP_034990820.1 DL88_RS01280 3-oxoadipyl-CoA thiolase
Query= SwissProt::Q0AVM3 (396 letters) >NCBI__GCF_000745425.1:WP_034990820.1 Length = 400 Score = 313 bits (801), Expect = 7e-90 Identities = 170/390 (43%), Positives = 243/390 (62%), Gaps = 9/390 (2%) Query: 12 RTPVGTFGGTLKDVGSAQLGAIVMGEAIKR-AGIKAEQIDEVIFGCVLQAGL-GQNVARQ 69 RTP+G +GG L V + L A+ + + R G+ ++E+ GC QAG +NVAR Sbjct: 11 RTPIGRYGGVLAPVRTDDLAALPLAALLARNPGLDPGAVEEIWMGCANQAGEDNRNVARM 70 Query: 70 CMINAGIPKEVTAFTINKVCGSGLRAVSLAAQVIKAGDADIIMAGGTENMDKAPFILPN- 128 ++ AG P V T+N++CGSGL AV+ AA+ I+ GD D+ +AGG E+M +APF++P Sbjct: 71 ALLLAGFPANVPGVTVNRLCGSGLEAVAAAARAIRTGDIDLAIAGGVESMTRAPFVIPKG 130 Query: 129 -ARWGYRMSMPKGDLIDEMVWGGLTDVFNGYHMGITAENINDMYGITREEQDAFGFRSQT 187 + W + + V + + M TA+N+ D Y ++RE+QDAF RSQ Sbjct: 131 ASAWSRASEIYDTTIGWRFVNPRIAAAYGTDSMPETAQNLADDYAVSREDQDAFALRSQE 190 Query: 188 LAAQAIESGRFKDEIVPVVI---KGKKGDIVFDTDEHPRKSTPEAMAKLAPAFKKGGSVT 244 AA A SGRF EI+PV + +GK D++ DEHPR +T +A+L P + GS+T Sbjct: 191 RAAAAQASGRFAAEILPVEVPLGRGKSLDVL--KDEHPRATTLADLARLKPITRPDGSIT 248 Query: 245 AGNASGINDAAAAVIVMSKEKADELGIKPMAKVVSYASGGVDPSVMGLGPIPASRKALEK 304 AGNASG+ND AAA+I+ S+ A G+ P+A+VV+ +S GV P +MG GP+PA + + Sbjct: 249 AGNASGVNDGAAALIIASEAAARRFGLTPLARVVAASSAGVAPRIMGYGPVPAVKTLCAR 308 Query: 305 AGLTIDDIDLIEANEAFAAQSIAVARDLGWADKMEKVNVNGGAIAIGHPIGSSGARILVT 364 G+++D I IE NEAFAAQ++ V R LG AD +VN NGGAIA+GHP+G SGARI T Sbjct: 309 TGISLDTIATIELNEAFAAQALVVLRQLGIADDDPRVNSNGGAIALGHPLGMSGARITGT 368 Query: 365 LLYEMQKRGSKKGLATLCIGGGMGTALIVE 394 E+ + G + LAT+C+G G G AL++E Sbjct: 369 AALELVRGGGRYALATMCVGVGQGAALLLE 398 Lambda K H 0.317 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 400 Length adjustment: 31 Effective length of query: 365 Effective length of database: 369 Effective search space: 134685 Effective search space used: 134685 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory