GapMind for catabolism of small carbon sources

 

Protein WP_034992816.1 in Beijerinckia mobilis UQM 1969

Annotation: NCBI__GCF_000745425.1:WP_034992816.1

Length: 357 amino acids

Source: GCF_000745425.1 in NCBI

Candidate for 85 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA med spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 44% 76% 224.6 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-cellobiose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 42% 77% 221.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-glucose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 42% 77% 221.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
lactose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 42% 77% 221.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-maltose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 42% 77% 221.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
sucrose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 42% 77% 221.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
trehalose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 42% 77% 221.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-maltose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 42% 77% 216.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
trehalose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 42% 77% 216.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
xylitol catabolism HSERO_RS17020 med ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 40% 79% 213.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 43% 72% 212.6 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-maltose catabolism malK med ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 40% 80% 209.1 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 40% 83% 205.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 42% 77% 203.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 42% 77% 203.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 42% 76% 198.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 42% 76% 198.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 42% 76% 198.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 41% 81% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-histidine catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 40% 81% 169.9 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-proline catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 40% 81% 169.9 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-histidine catabolism aapP med ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 41% 82% 146.4 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 37% 93% 224.2 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 40% 85% 218.4 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 39% 93% 215.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 38% 92% 215.3 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 90% 214.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 38% 85% 213.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 38% 98% 213.4 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 38% 98% 213.4 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 38% 85% 212.6 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 39% 92% 211.1 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 82% 206.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 42% 69% 206.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 82% 206.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 82% 206.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 82% 206.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 82% 206.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 82% 206.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 82% 206.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 82% 206.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 39% 90% 206.1 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 37% 92% 206.1 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 39% 75% 204.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 40% 76% 203 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 79% 198 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 79% 198 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 79% 198 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 79% 198 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 40% 80% 193 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 33% 95% 192.6 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 38% 83% 184.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 42% 57% 183 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 74% 174.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 74% 174.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 74% 174.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 74% 174.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 74% 174.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 74% 174.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 37% 74% 168.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 37% 62% 167.2 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 37% 76% 156.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtM (characterized) 37% 98% 149.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 36% 65% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 37% 90% 147.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-lysine catabolism hisP lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 37% 90% 147.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 38% 84% 146 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 38% 84% 146 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 36% 96% 143.3 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 85% 142.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 85% 142.5 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 82% 141.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 82% 141.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 82% 141.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 82% 141.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 82% 141.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 39% 83% 141 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 35% 92% 140.2 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 38% 90% 138.3 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-histidine catabolism hisP lo histidine transport ATP-binding protein hisP (characterized) 32% 98% 136.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 33% 98% 134.8 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 35% 90% 134.4 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 32% 83% 131.7 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 37% 77% 129.4 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 34% 80% 119.4 CysA aka B2422, component of Sulfate/thiosulfate porter 51% 297.0

Sequence Analysis Tools

View WP_034992816.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MQIRVVDIVKQFDPRAKGPVLDQINLNVVGGELLALLGPSGSGKTTLLRIIAGLDQPTGG
KVFFGEEDASGLRVQERRVGFVFQNYALFKHLTLEENIAFGLTVRDRATRPPKAEIRRRA
LELLDLVQLSGLGKRYPAQLSGGQRQRVALARALAVEPRVLLLDEPFGALDAKVRRDLRL
WLRELHDRTGHTTLFVTHDQDEALELADRVAVLSQGRIEQIGSPDEIYDHPATAFVHGFI
GESSALRVNAREGRLFIGDRPLSIPLREERPGWGRLFIRPQDVVIGEKGLSETGRPPIEA
EVLSLWRSGPTRRAELALAGEAGRIEIDAPVATPLTPGEKVPLHFKRGTFYLETPAA

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory