Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate WP_035238407.1 Q366_RS09470 3-oxoacyl-ACP reductase FabG
Query= uniprot:Q8EGC1 (252 letters) >NCBI__GCF_000745975.1:WP_035238407.1 Length = 245 Score = 122 bits (306), Expect = 7e-33 Identities = 90/254 (35%), Positives = 136/254 (53%), Gaps = 26/254 (10%) Query: 6 KVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQDK------LERACADLGSSTEVQGYA 59 K VITG + G+G A+A A G +I+ DK LE+ A GS+ E+ + Sbjct: 8 KTAVITGASRGIGRAIAIELAGQGY-YTIINYHSDKDGAAHTLEQVRA-AGSNGEIMQF- 64 Query: 60 LDITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVIN 119 D+ D E A IL I+VLVNNAGI+ DG+ + K+ + + VI Sbjct: 65 -DVADREQSKAAIDTILGRCETIDVLVNNAGIVADGLFIMMKE---------ESWDKVIR 114 Query: 120 VNLTGTFLCGREAAAAMIESGQAGVIVNISSLAK-AGNVGQSNYAASKAGVAAMSVGWAK 178 +L G + + M+ + G +V+I+SL+ GN GQ+NY+A+KAG+ S A Sbjct: 115 TSLDGFYNMTKPVLKKMVRQ-KRGAVVSIASLSGLTGNRGQANYSAAKAGLIGASRSIAT 173 Query: 179 ELARYNIRSAAVAPGVIATEMTAAMKPEALERLEKLVPVGRLGHAEEIASTVRFIIEND- 237 E+AR IR VAPG+I T+MT K L ++ ++P+ R+G E+A V+F+ +D Sbjct: 174 EVARLGIRINVVAPGLIETDMT---KDLPLPNVKTMIPMARMGRPGEVARVVKFLCSDDA 230 Query: 238 -YVNGRVFEVDGGI 250 YV G+V V+GG+ Sbjct: 231 SYVTGQVISVNGGM 244 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 245 Length adjustment: 24 Effective length of query: 228 Effective length of database: 221 Effective search space: 50388 Effective search space used: 50388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory