Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_035241898.1 Q366_RS18135 enoyl-CoA hydratase
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_000745975.1:WP_035241898.1 Length = 261 Score = 151 bits (381), Expect = 2e-41 Identities = 94/260 (36%), Positives = 142/260 (54%), Gaps = 5/260 (1%) Query: 3 EFILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAG-RGFC 61 E I+ ++ + +T NRP+ LN+ N+ + +L L QV + IR L+LTG+G + F Sbjct: 4 ENIILEMDSTIAMITFNRPKALNALNNALLDELDVALDQVLANKEIRVLILTGSGDKAFV 63 Query: 62 AGQDLNDRNVDPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGG 121 AG D+++ T A ++ ++ ++ LP P I AVNG A G G+ +AL Sbjct: 64 AGADISELTRMDTLAAKYFSRKGQKIFS----KIEALPFPAIAAVNGFALGGGSEVALAC 119 Query: 122 DIVIAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMI 181 D + A+ A F + LGLIP GGT LPR+ G+ RA + G ++A++A E+GM+ Sbjct: 120 DFIYASEKAVFGLPEINLGLIPGFGGTQRLPRLVGKNRAKEMIFTGANITADKALEYGMV 179 Query: 182 WQVVDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGRS 241 QV E+L D Q+ AR +A + L K+AI + L+T +E D +A S Sbjct: 180 NQVCPHESLMDEVQKTARRIAGKGCVSLRAAKEAIQAGMGCDLETGCLIENDAFAIAVAS 239 Query: 242 ADYREGVSAFLAKRSPQFTG 261 D +EG SAFL KR P+F G Sbjct: 240 PDAKEGTSAFLEKRKPEFKG 259 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 261 Length adjustment: 25 Effective length of query: 237 Effective length of database: 236 Effective search space: 55932 Effective search space used: 55932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory