Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate WP_035245002.1 G494_RS0100150 C4-dicarboxylate ABC transporter
Query= SwissProt::A3QCW5 (336 letters) >NCBI__GCF_000429965.1:WP_035245002.1 Length = 330 Score = 430 bits (1106), Expect = e-125 Identities = 220/326 (67%), Positives = 255/326 (78%), Gaps = 5/326 (1%) Query: 15 KMTSIAALLGASLNS-----WAAPTEIKFSHVVAENTPKGQMALKFKQLVEERLPGEYQV 69 K+T AA L S WA P IKFSHVVAENTPKGQMA KFK LV ERL G+ V Sbjct: 4 KVTLAAAALAISAAFAVGPVWAKPVVIKFSHVVAENTPKGQMANKFKDLVAERLGGKVVV 63 Query: 70 NVFPNSQLFGDNNELSALLLNDVQFVAPSLSKFERYTKKLQLFDLPFLFKDMDAVNRFQQ 129 V+PNSQLFGDN L A+LL DVQ APSLSKFERYTKK+ L+DLPFLF+DM AV++FQ Sbjct: 64 EVYPNSQLFGDNKVLEAMLLGDVQMAAPSLSKFERYTKKVALYDLPFLFEDMAAVDKFQS 123 Query: 130 SDAGQQLLNSMKRKGVVGLGYLHNGMKQFSASSPLVLPEDAQGKKFRIMASDVLAAQFQA 189 S GQ +L +MK+KG+VGLGYLHNG+KQ S+S PL +P D G KFRIM+SDVLAAQF+A Sbjct: 124 SKEGQDMLAAMKKKGLVGLGYLHNGLKQLSSSKPLKVPADVAGLKFRIMSSDVLAAQFKA 183 Query: 190 VEAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQSNITESNHGVLDYMVVTSN 249 V+A P+KKPFSEVFTLLQTRAIDGQENTWSNIYSKKF+EVQ ITESNHG+LDYMVVTS Sbjct: 184 VKATPLKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFFEVQPYITESNHGLLDYMVVTSA 243 Query: 250 TFWKSLPADKRKVIKASLDEAIAYGNEIAAAKVNKDKQAIIDSKRSEVTYLTPEQRAAWV 309 FW L + R +K +LDEAI +GN++AA K DKQ IIDSKRS++ LTPE+RA WV Sbjct: 244 EFWMDLSDELRVEVKKALDEAILFGNKVAADKAKTDKQKIIDSKRSQILELTPEERAQWV 303 Query: 310 NAMKPVWAQFEDKIGKDLIDAAVASN 335 MKPVW +FE +IGK+LIDAA +N Sbjct: 304 EVMKPVWKKFEHEIGKELIDAAYNAN 329 Lambda K H 0.317 0.130 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 330 Length adjustment: 28 Effective length of query: 308 Effective length of database: 302 Effective search space: 93016 Effective search space used: 93016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory