Align fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_035247977.1 G494_RS24870 carbohydrate kinase
Query= BRENDA::G4T023 (295 letters) >NCBI__GCF_000429965.1:WP_035247977.1 Length = 302 Score = 272 bits (696), Expect = 6e-78 Identities = 139/285 (48%), Positives = 183/285 (64%) Query: 8 IFGEVLFDHFPDGSRVLGGAPFNVAWHLQAFRQEPHFISRVGQDATGDSVIAAMHKWGMD 67 IFGEVLFD FPDG+ VLGGAPFNVAWHLQ+F P +SRVG D G +I AM+ GMD Sbjct: 8 IFGEVLFDCFPDGAEVLGGAPFNVAWHLQSFGAAPLLVSRVGDDERGRRIIQAMNDQGMD 67 Query: 68 MSGLQRDSRHPTGVVDIVIEQGEPAYTIVPEQAYDYIDEDELQDTDRPGLLYHGTLSLRQ 127 LQ D + TG V+I ++QG+P+YTI +QA+ +I+ + Q R L+YHG+L+L Sbjct: 68 RGALQLDRQRATGTVEIHLQQGQPSYTISLDQAFGWIEVEPAQLPRRAALIYHGSLALWH 127 Query: 128 PVSRAALDVLKDAHKGRIFMDVNLREPWWQKDQVLEWLGQADWVKLNHHELAALYPVSGD 187 P SR AL L+D +F+DVNLR PWW++ VL L A WVKLN EL L P G Sbjct: 128 PESRQALSRLRDHCAAPLFIDVNLRPPWWERAAVLSLLEGASWVKLNDEELEQLQPQPGS 187 Query: 188 LKADMRRFVELYRLQGLIVTSGKQGAFATDHQGVSCRVTPGEIAQVIDTVGAGDAFASVM 247 + ++R ++ YRLQG+I+T G+QGA G V P V+DTVGAGD F++V Sbjct: 188 DQDRVQRLLKRYRLQGVILTRGEQGARLFLADGRQLEVKPAGELPVVDTVGAGDGFSAVC 247 Query: 248 LLGLNLDWPLQITMERAQAFASAMVGQRGATVRDPVFYEPFIAAW 292 +LGL WP ++ +ERAQ FAS ++ Q+GAT+ DP Y + W Sbjct: 248 ILGLLRGWPPELMLERAQEFASVLIAQQGATIADPGLYATLLQRW 292 Lambda K H 0.322 0.138 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 302 Length adjustment: 27 Effective length of query: 268 Effective length of database: 275 Effective search space: 73700 Effective search space used: 73700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory