Align sucrose synthase (EC 2.4.1.13) (characterized)
to candidate WP_035247989.1 G494_RS0120970 glycosyl transferase family 1
Query= BRENDA::Q00917 (807 letters) >NCBI__GCF_000429965.1:WP_035247989.1 Length = 729 Score = 191 bits (485), Expect = 1e-52 Identities = 147/487 (30%), Positives = 235/487 (48%), Gaps = 48/487 (9%) Query: 280 ILSPHGYF-GQANVLGLP-DTGGQVVYILDQVRALENEMLLRIQKQGLEVIPKILIVTRL 337 + SPHG G + LG DTGGQV Y+L+ L EM R E + ++ +VTRL Sbjct: 10 LFSPHGLIRGHSPELGRDADTGGQVKYVLE----LAKEMGRR------EEVAQVDLVTRL 59 Query: 338 LPEAKGTTCNQRLERVSGTEHAHILRIPFRTEKGILRKWISRFDVWPYLETFAEDASNEI 397 + + K + + +EHA I+RI RK+I + +WP+LE F + I Sbjct: 60 IDD-KSVADDYSVAIEPLSEHARIVRIRCGG-----RKYIRKELLWPHLEEFIDKTIRFI 113 Query: 398 SAELQGVPNLIIGNYSDGNLVASLLASKLGVIQCNIAHAL---EKTKYPESDIYWRNHED 454 ++ + P+L G+Y+DG VA LA+ H+L ++ K + + Sbjct: 114 KSQAKS-PDLFHGHYADGGYVAMELAAAFDAPFLFTGHSLGSNKRQKLAQEGVSAARMNR 172 Query: 455 KYHFSSQFTADLIAMNNADFIITSTYQEIAGSKNNVGQYESHTAFTMPGLYRVVHGIDVF 514 +Y ++ + M AD IITST QEI QY GLY + Sbjct: 173 QYKLDTRILVEEEIMRKADRIITSTQQEIDL------QY---------GLYS-----NGR 212 Query: 515 DPKFNIVSPGADMTIYFPYSDKERRLTALHESIEELLFSAEQNDEHVGLLSDQSKPIIFS 574 P F+++ PG D+ ++P+ D + L E +++ F+ N+ H + KP I + Sbjct: 213 IPDFSVIPPGIDLETFYPFYDLQMDTELLSEEVKQTRFTLF-NELH-RFWAHPEKPFILA 270 Query: 575 MARLDRVKNLTGLVECYAKNSKLRELANLVIVGGYIDENQSRDREEMAEIQKMHSLIEQY 634 + R D+ KN++GL+E Y + +LR +ANL I G + + E A + M +++Y Sbjct: 271 LCRPDQRKNISGLLEAYGTSKELRAIANLAIFAGIRSNITAMEDNEQAVLTDMLLQMDRY 330 Query: 635 DLHGEFRWIAAQMNRARNGELYRYIADTKGVFVQPAFYEAFGLTVVESMTCALPTFATCH 694 DL+G+ ELYR A+++GVFV PA E FGLT++E+ C LP AT Sbjct: 331 DLYGKLAIPKRHDFATEVPELYRICAESRGVFVNPALTEPFGLTLIEASACGLPLVATQD 390 Query: 695 GGPAEIIENGVSGFHIDPYHPDQVAATLVSFFETCNTNPNHWVKISEGGLKRIYERYTWK 754 GGP +I+ N +G +D P ++A L S + W + S G+ + Y+W+ Sbjct: 391 GGPRDIVGNCDNGILVDVAQPREIAQALQSIL----VDEAQWSRFSNNGINGVRNHYSWQ 446 Query: 755 KYSERLL 761 ++E+ L Sbjct: 447 AHAEKSL 453 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1278 Number of extensions: 76 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 807 Length of database: 729 Length adjustment: 41 Effective length of query: 766 Effective length of database: 688 Effective search space: 527008 Effective search space used: 527008 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory