Align methylmalonyl-CoA epimerase (EC 5.1.99.1) (characterized)
to candidate WP_035254949.1 H567_RS0117290 hypothetical protein
Query= BRENDA::Q96PE7 (176 letters) >NCBI__GCF_000422285.1:WP_035254949.1 Length = 151 Score = 65.1 bits (157), Expect = 5e-16 Identities = 40/127 (31%), Positives = 63/127 (49%), Gaps = 4/127 (3%) Query: 47 RLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDS 106 + NHV IAV DLE A AF+ ++ G ++ + V ++ELL L +S Sbjct: 20 KFNHVGIAVRDLENAVAFFGDVYGTRLLRKDRYEDELFESAIVETAGMRIELLAGLAPES 79 Query: 107 PIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDC 166 I+ F+ K + G+HH+ +EV+ A V LK K++ L E F+HP+ Sbjct: 80 FISQFV-KERGEGIHHMSLEVEQFEAVVQGLKFKRLTILGETEN---ENFKACFVHPRGN 135 Query: 167 GGVLVEL 173 G+L E+ Sbjct: 136 HGILTEI 142 Lambda K H 0.318 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 61 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 176 Length of database: 151 Length adjustment: 18 Effective length of query: 158 Effective length of database: 133 Effective search space: 21014 Effective search space used: 21014 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory