Align glucokinase (EC 2.7.1.2) (characterized)
to candidate WP_035628882.1 P166_RS0106610 hypothetical protein
Query= reanno::SB2B:6938110 (299 letters) >NCBI__GCF_000711315.1:WP_035628882.1 Length = 300 Score = 294 bits (752), Expect = 2e-84 Identities = 152/299 (50%), Positives = 200/299 (66%), Gaps = 5/299 (1%) Query: 1 MMRMGVDLGGTKIELVALGEDGSELFRKRIATPR-EYQGTLNAVVTLVNEAEATLGTQGS 59 M+ GVDLGGTKIE++ L +D S LFR R++TP+ Y+ TL+A+V L + AE T+G+ + Sbjct: 1 MLYCGVDLGGTKIEIIVLTDDNSTLFRHRVSTPQGNYEKTLDAIVELFHLAEETVGSLNA 60 Query: 60 LGIGIPGVISPYTGLVKNANSTWINGHPLDRDLGALLNREVRVANDANCFAVSEAVDGAA 119 LGIGIPG IS TG +KNANS + L DL + L +V ++NDANCFA+SEAVDGA Sbjct: 61 LGIGIPGAISQRTGRIKNANSVCLIDQDLKADLQSRLGCKVYLSNDANCFALSEAVDGAG 120 Query: 120 AGKRVVFGAILGTGCGAGLAFDGRVHEGGNGIGGEWGHNPLPWMRPDEFNTTECFCGNKD 179 G + VFG I+GTGCG GL +G+ +G N I GEWGHNPLPW+ P+E C+CG Sbjct: 121 EGAKTVFGVIIGTGCGGGLVINGQSLDGANFIAGEWGHNPLPWLEPNE-TALPCYCGKSG 179 Query: 180 CIETFVSGTGFVRDFRNSGGTAQNGAEIMSLVDAGDEL---ANLVFDRYLDRLARSLAHV 236 CIETF+SG GFV+ F G + + EI++LV+ L A +RY + LA+ LA V Sbjct: 180 CIETFLSGPGFVKHFELISGHSLSTQEIVALVEEDSSLSDTAKQALERYCEWLAKGLASV 239 Query: 237 INMLDPDAIVLGGGMSNVQAIYARLPAILPKYVVGRECRTPVVQNLYGCSSGVRGAAWL 295 IN+ DP+ IVLGGGMSN+ IY R+P I +V + T + + +G SSGVRGAAWL Sbjct: 240 INIFDPEVIVLGGGMSNIDYIYRRVPEIWGNWVFSDQVLTQLAKAKWGDSSGVRGAAWL 298 Lambda K H 0.320 0.139 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 300 Length adjustment: 27 Effective length of query: 272 Effective length of database: 273 Effective search space: 74256 Effective search space used: 74256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory