Align Histidine transport ATP-binding protein HisP (characterized)
to candidate WP_035629258.1 P166_RS0103830 ABC transporter ATP-binding protein
Query= SwissProt::P02915 (258 letters) >NCBI__GCF_000711315.1:WP_035629258.1 Length = 550 Score = 128 bits (322), Expect = 2e-34 Identities = 84/262 (32%), Positives = 140/262 (53%), Gaps = 30/262 (11%) Query: 10 IDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKS----TFLRCINFLEKPSEGAIIV 65 ++L K + ++ VS + +AG++ +++G SGSGKS +R + + S GAI + Sbjct: 15 VELEKNH--RPLISNVSFEIKAGEIFALVGESGSGKSLTSLAIMRLLPEALQVSSGAISL 72 Query: 66 NGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV---- 121 N Q G + + ++ ++ M+FQ MT L VM+ QV Sbjct: 73 NHQ---------GLFSLPEYQMQKVRGRQVAMIFQE-----PMTSLNPVMKVGDQVAEVL 118 Query: 122 ---LGLSKHDARERALKYLAKVGID--ERAQGKYPVHLSGGQQQRVSIARALAMEPDVLL 176 LG+++ ARE+ + +VGI E YP LSGGQ+QRV IA ALA EPD+L+ Sbjct: 119 RVHLGMNRKTAREKVVSLFDEVGIPNPEERYDWYPHQLSGGQKQRVMIAMALACEPDLLI 178 Query: 177 FDEPTSALDPELVGEVLRIMQQLAEE-GKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEG 235 DEPT+ALD + +VL +++Q+ ++ G ++ +TH+MG ++ V + G+I E+ Sbjct: 179 ADEPTTALDVTIQAQVLNLLKQIRDDRGLAILFITHDMGVVNEIADRVAVMKDGEIVEQA 238 Query: 236 DPEQVFGNPQSPRLQQFLKGSL 257 + F +PQ P Q+ L ++ Sbjct: 239 ETGHFFTDPQHPYTQKLLSDAI 260 Score = 117 bits (293), Expect = 5e-31 Identities = 81/256 (31%), Positives = 140/256 (54%), Gaps = 16/256 (6%) Query: 12 LHKRYGGH-EVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNI 70 + +R GH + + GV+L G ++++G SGSGKST + I L + G + Sbjct: 293 IFQRTVGHVKAVDGVNLTIPKGQTLALVGESGSGKSTIGQAILKLVDATAG-------QV 345 Query: 71 NLVRDKDGQ-LKVADKNQ--LRLLRTRLTMVFQH--FNLWSHMTVLENVMEA--PIQVLG 123 N D+ Q + + D ++ ++ R ++ ++FQ L MT+ E + E +QV Sbjct: 346 NFTNDQAAQAINLVDLSEKAMKPFRKKVQVIFQDPFSALNPRMTINEIIREGMNSLQVGP 405 Query: 124 LSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSA 183 S+ + +R L +VG+ + +YP SGGQ+QR+ IARALA+EP++++ DEPTSA Sbjct: 406 KSRVEQDKRIESLLEQVGLLPEHKYRYPHEFSGGQRQRIGIARALAVEPELIICDEPTSA 465 Query: 184 LDPELVGEVLRIMQQLAEEGK-TMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFG 242 LD + +VL +++ L + + + + +TH++ ++ HV + GKI E+G E+V Sbjct: 466 LDVSVRAQVLALLKDLQKTYQMSYLFITHDLSIVPSIAHHVAVMQAGKIVEQGLVEEVMQ 525 Query: 243 NPQSPRLQQFLKGSLK 258 NPQ Q+ L + K Sbjct: 526 NPQHDYTQRLLASAPK 541 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 258 Length of database: 550 Length adjustment: 30 Effective length of query: 228 Effective length of database: 520 Effective search space: 118560 Effective search space used: 118560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory