Align acetyl-CoA:acetyl-CoA C-acetyltransferase / acetyl-CoA:propanoyl-CoA 2-C-acetyltransferase (EC 2.3.1.9; EC 2.3.1.16) (characterized)
to candidate WP_036255240.1 METAC_RS0102805 acetyl-CoA C-acyltransferase
Query= reanno::pseudo3_N2E3:AO353_25685 (397 letters) >NCBI__GCF_000427445.1:WP_036255240.1 Length = 400 Score = 548 bits (1412), Expect = e-160 Identities = 271/389 (69%), Positives = 323/389 (83%) Query: 6 DPIVIVSAVRTPMGGFQGELKSLSAPQLGAAAIRAAVERAGVAADAVEEVLFGCVLSAGL 65 DPIVI SA RTP+GGFQG+ K L+AP+LGAAAI AAVER+G+ + ++E + GCVL+AG Sbjct: 10 DPIVIASAARTPIGGFQGDFKDLAAPRLGAAAIAAAVERSGLHPEDIDEAILGCVLTAGQ 69 Query: 66 GQAPARQAALGAGLDKSTRCTTLNKMCGSGMEAAILAHDMLLAGSADVVVAGGMESMSNA 125 GQAPARQAAL AGL + C T+NKMCGSGM+A +LAHD+L AGSA +VAGGMESM+NA Sbjct: 70 GQAPARQAALAAGLPAAAGCLTINKMCGSGMKAIMLAHDLLQAGSATAIVAGGMESMTNA 129 Query: 126 PYLLDRARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEANGFTREAQDEFAI 185 PYLL+R R+GYRMGHG++LDHMFLDGLEDAY LMG FAE CA+A FTREAQD +A Sbjct: 130 PYLLERTRAGYRMGHGRLLDHMFLDGLEDAYGAHPLMGVFAESCAQAFQFTREAQDAYAT 189 Query: 186 ASTTRAQQAIKDGSFNAEIVPLQVIVGKEQKLITDDEQPPKAKLDKIASLKPAFRDGGTV 245 AS RAQ+AI+DG+F EI P+ GK +K+I DEQP KAKLDKIA+LKPAF++GGTV Sbjct: 190 ASLLRAQKAIRDGNFIDEIAPVAAPAGKAEKIILHDEQPLKAKLDKIAALKPAFKEGGTV 249 Query: 246 TAANSSSISDGAAALLLMRRSEAEKRGLKPLAVIHGHAAFADTPGLFPVAPVGAIKKLLK 305 TAANSSSISDGA AL+LMRRSEAEKRGL+PLA I HA+ A P FP AP+GA++KL+ Sbjct: 250 TAANSSSISDGATALVLMRRSEAEKRGLRPLATIRAHASHAQAPDQFPTAPIGALRKLMD 309 Query: 306 KTGWSLDEVELFEVNEAFAVVSLVTMTKLEIPHSKVNVHGGACALGHPIGASGARILVTL 365 KTGW+L +V+LFE+NEAFAVV++ M +L +PH KVNVHGGACALGHPIGASGARI+ TL Sbjct: 310 KTGWALRDVDLFEINEAFAVVAMAAMRELALPHEKVNVHGGACALGHPIGASGARIVATL 369 Query: 366 LSALRQKGLKRGVAAICIGGGEATAMAVE 394 L+AL+ GLKRG AAICIGGGEATA+AVE Sbjct: 370 LAALKTYGLKRGAAAICIGGGEATALAVE 398 Lambda K H 0.318 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 400 Length adjustment: 31 Effective length of query: 366 Effective length of database: 369 Effective search space: 135054 Effective search space used: 135054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_036255240.1 METAC_RS0102805 (acetyl-CoA C-acyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.23257.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-126 408.2 9.4 1.9e-126 408.0 9.4 1.0 1 lcl|NCBI__GCF_000427445.1:WP_036255240.1 METAC_RS0102805 acetyl-CoA C-acy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000427445.1:WP_036255240.1 METAC_RS0102805 acetyl-CoA C-acyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 408.0 9.4 1.9e-126 1.9e-126 1 385 [] 14 398 .. 14 398 .. 0.97 Alignments for each domain: == domain 1 score: 408.0 bits; conditional E-value: 1.9e-126 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaag 69 i +a+Rtpig ++g +k+l a L+aa+i +++er+gl+pe+ide+ilG+vl+ag+++++aR+aalaag lcl|NCBI__GCF_000427445.1:WP_036255240.1 14 IASAARTPIGGFQGDFKDLAAPRLGAAAIAAAVERSGLHPEDIDEAILGCVLTAGQGQAPARQAALAAG 82 789*******99********************************************************* PP TIGR01930 70 lpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakled 138 lp lt+n++C+Sg++A++la + ++aG a+++vaGG+Esm+++p+ll++ r+++++g+ +l d lcl|NCBI__GCF_000427445.1:WP_036255240.1 83 LPAAAGCLTINKMCGSGMKAIMLAHDLLQAGSATAIVAGGMESMTNAPYLLERT--RAGYRMGHGRLLD 149 ****************************************************97..89*********** PP TIGR01930 139 qllkdl....vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk.. 201 ++ d+ ++ mg+ Ae++a+ ++++Re qD+ya +S +a+kAi++g+f dei pv + lcl|NCBI__GCF_000427445.1:WP_036255240.1 150 HMFLDGledaYGAHPLMGVFAESCAQAFQFTREAQDAYATASLLRAQKAIRDGNFIDEIAPVAAPAGka 218 9999999998778999**********************************************9987788 PP TIGR01930 202 kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplariv 270 +k++ +De++ + +l+k+a Lkpafke g tvtA+Nss+++DGA+al+lm ++ a++ gl+pla+i+ lcl|NCBI__GCF_000427445.1:WP_036255240.1 219 EKIILHDEQPL-KAKLDKIAALKPAFKE-GG-TVTAANSSSISDGATALVLMRRSEAEKRGLRPLATIR 284 88888888887.899***********96.68.7************************************ PP TIGR01930 271 saavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAi 339 ++a + p++++++p+ A +k+++k+g+ ++d+dl+EinEAFA++++a+++el+ l +ekvNv+GGA lcl|NCBI__GCF_000427445.1:WP_036255240.1 285 AHASHAQAPDQFPTAPIGALRKLMDKTGWALRDVDLFEINEAFAVVAMAAMRELA-LPHEKVNVHGGAC 352 *******************************************************.88*********** PP TIGR01930 340 AlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 AlGHP+GasGariv+tll +Lk g k+G a++C+ggG ++A+ +e lcl|NCBI__GCF_000427445.1:WP_036255240.1 353 ALGHPIGASGARIVATLLAALKTYGLKRGAAAICIGGGEATALAVE 398 ******************************************9886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (400 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 8.91 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory