Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate WP_036257290.1 DL86_RS00860 enoyl-CoA hydratase
Query= curated2:Q52995 (257 letters) >NCBI__GCF_000746085.1:WP_036257290.1 Length = 250 Score = 115 bits (287), Expect = 1e-30 Identities = 77/248 (31%), Positives = 121/248 (48%), Gaps = 2/248 (0%) Query: 4 ETLLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFDADRAVGAIVLAGSEKAFAA 63 E + +E G + +T +RP+ NAL + AL D + ++GAI++ GS AF A Sbjct: 3 EYVKIERDGAILCLTFDRPEKKNALTGAMYLAAAEALITADREESIGAILIGGSGGAFTA 62 Query: 64 GADIKEMQGLDFVDGYLADFLGGWEHVANARKPMIAAVSGFALGGGCELAMMCDFIIASE 123 G DI + G F + +A ++ P+IAA+ G A+G G + + CD + Sbjct: 63 GNDIADFLQFGGEPGEFPAF-AFIKTLAASQTPLIAAIEGPAIGIGATMILHCDLAYVAP 121 Query: 124 TAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRVVAPD 183 A F P + LG++P S L R +G AKA + +L G A EA R GL + +VA D Sbjct: 122 DATFRMPFVDLGLVPEAASSLLLPRRIGMAKASEFLLLGEPFGAQEAVRLGLANAIVAAD 181 Query: 184 RLLEEALGAAEKIASFSLPAAMMAKEAVNRSLELTLAEGLRFERRLFQSLFATEDQKEGM 243 RL A+ A+ IA+ A + + ++ A + E RLF + + + Sbjct: 182 RLRPFAIERAKWIAAKPREAIQATRRLLRGDVQEIRAR-IEEEARLFAGALQSAEARAAF 240 Query: 244 AAFVAKRK 251 AAF++K K Sbjct: 241 AAFLSKPK 248 Lambda K H 0.321 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 250 Length adjustment: 24 Effective length of query: 233 Effective length of database: 226 Effective search space: 52658 Effective search space used: 52658 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory