Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate WP_036257477.1 DL86_RS01770 enoyl-CoA hydratase/isomerase family protein
Query= curated2:Q52995 (257 letters) >NCBI__GCF_000746085.1:WP_036257477.1 Length = 354 Score = 100 bits (250), Expect = 3e-26 Identities = 71/217 (32%), Positives = 108/217 (49%), Gaps = 13/217 (5%) Query: 1 MSYETLLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFDADRAVGAIVLAGSEKA 60 MS + E GR G+ITL+RP LNAL ++RE+ AL +++D AV +++ + +A Sbjct: 1 MSEPEITCEKIGRCGVITLDRPNVLNALTLNMVREIARALDLWESDPAVQTVLIRAAGRA 60 Query: 61 FAAGADIKEMQGLDFVDGYLADFLGGW--EHVANAR-----KPMIAAVSGFALGGGCELA 113 F AGADI+ + L Y AD L W E+ N R KP +A + G +GGG ++ Sbjct: 61 FCAGADIRNLYELGRAGRY-ADQLAFWREEYCLNRRIKLYPKPYVALIDGIVMGGGAGVS 119 Query: 114 MMCDFIIASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERS 173 + I+A + F PE+ +G P +G + L R GK + L LTG M +A Sbjct: 120 LHGSHIVAGDDFNFAMPEVGIGFFPDVGATFFLPRLPGKT-GVYLALTGARMTCGDA--- 175 Query: 174 GLVSRVVAPDRLLEEALGAAEKIASFSLPAAMMAKEA 210 L V A A+++ P+A +A E+ Sbjct: 176 -LAFEVAAAYAPSARHAALAQRLIEGEDPSAAIAAES 211 Lambda K H 0.321 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 354 Length adjustment: 27 Effective length of query: 230 Effective length of database: 327 Effective search space: 75210 Effective search space used: 75210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory