Align short-chain acyl-CoA dehydrogenase monomer (EC 1.3.8.1) (characterized)
to candidate WP_036259933.1 DL86_RS07065 acyl-CoA dehydrogenase
Query= metacyc::MONOMER-17424 (375 letters) >NCBI__GCF_000746085.1:WP_036259933.1 Length = 400 Score = 200 bits (509), Expect = 5e-56 Identities = 125/371 (33%), Positives = 187/371 (50%), Gaps = 3/371 (0%) Query: 3 VNDEQQQIADAVRAFAQERLKPFAEQWDKDHRFPKEAIDEMAELGLFGMLVPEQWGGSDT 62 +++++ + + RAFAQE L P D RF + + +M E GL G +P+ +GG+ Sbjct: 24 LSEDESLVRGSARAFAQEVLLPRVTDDYLDERFDRVIMTKMGEFGLLGPTIPQAYGGAGL 83 Query: 63 GYVAYAMALEEIAAGDGACSTIMSVHNSVGCVPILRFGNEQQKEQFLTPLATGAMLGAFA 122 GYVAY +A E+ D + MSV +S+ PI +G+E Q+ ++L LA G +G F Sbjct: 84 GYVAYGLAAREVERVDSGYRSAMSVQSSLVMHPIHAYGSEDQRRKYLPRLARGEWIGCFG 143 Query: 123 LTEPQAGSDASSLKTRARLEGDHYVLNGSKQFITSGQNAGVVIVFAVTDPEAGKRGISAF 182 LTEP+AGSD ++ RA Y L G+K +IT+ A + +V+A + A I F Sbjct: 144 LTEPEAGSDPQGMRARAEKTSRGYRLTGAKTWITNSPLADIFVVWAKS--AAHDNAIRGF 201 Query: 183 IVPTDSPGYQVARVEDKLGQHASDTCQIVFDNVQVPVANRLGAEGEGYKIALANLEGGRI 242 ++ G + KL AS T +I+ D V+VP N L G K L R Sbjct: 202 LLERGMAGLTTPTIGQKLSLRASATGEIIMDGVEVPEQNLL-PNASGLKGPFGCLNRARY 260 Query: 243 GIASQAVGMARAAFEVARDYANERQSFGKPLIEHQAVAFRLADMATKISVARQMVLHAAA 302 GIA +G A A FE AR Y+ +R+ FG+PL +Q + +LADM T+I++ Q L Sbjct: 261 GIAWGTMGAAEACFEAARAYSLDRRQFGRPLAANQLIQKKLADMETEIALGLQAALRIGR 320 Query: 303 LRDAGRPALVEASMAKLFASEMAEKVCSDALQTLGGYGYLSDFPLERIYRDVRVCQIYEG 362 L + R S+ K S A + A G G + F + R ++ YEG Sbjct: 321 LFEEDRLTPEAISLVKRNNSGKALDIARMARDMHGANGISAAFHVMRHLANLETVNTYEG 380 Query: 363 TSDIQRMVIAR 373 TSDI +++ R Sbjct: 381 TSDIHALILGR 391 Lambda K H 0.319 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 400 Length adjustment: 30 Effective length of query: 345 Effective length of database: 370 Effective search space: 127650 Effective search space used: 127650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory