Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_036260808.1 DL86_RS10065 polyamine ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000746085.1:WP_036260808.1 Length = 376 Score = 137 bits (346), Expect = 3e-37 Identities = 79/239 (33%), Positives = 130/239 (54%), Gaps = 6/239 (2%) Query: 23 IQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVD 82 +Q+ + K +G + ++LT+ RGE + GPSG GK++++R I E G+I +D Sbjct: 12 VQLEGVTKRHGGVAAVDALSLTLRRGEFFALLGPSGCGKTSLLRLIAGFETPDEGRIFID 71 Query: 83 GIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYYL 142 G ++T + R V M+FQ + LFPH+ + N+ + + + E L Sbjct: 72 GEDVTGTPPH----RRPVNMMFQTYALFPHMNVARNIGFGLVQ-EGIARAEIARRVTEML 126 Query: 143 EKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMIQ 202 V++ ++ P QLSGGQ+QRVA+AR+L +PK++L DEP +ALD + +E ++ Sbjct: 127 RLVQLEGLGERRPDQLSGGQKQRVALARALVKRPKLLLLDEPLAALDRRLREETQFELMH 186 Query: 203 LAEE-GMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFLSQI 260 L E G T L VTH+ A +A+R+ M G+I + P + + P S QF+ +I Sbjct: 187 LQERLGATFLVVTHDQREAMVMASRIGVMRAGRIEQIGAPAEIYERPISSYVAQFIGEI 245 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 376 Length adjustment: 27 Effective length of query: 236 Effective length of database: 349 Effective search space: 82364 Effective search space used: 82364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory