Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_036371340.1 MVAN_RS22995 enoyl-CoA hydratase
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_000015305.1:WP_036371340.1 Length = 273 Score = 169 bits (427), Expect = 7e-47 Identities = 96/255 (37%), Positives = 142/255 (55%), Gaps = 7/255 (2%) Query: 9 VEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQDLND 68 ++ GV+T+TLNRP LNS M A L++ D +R + + GAGRGFC+G +++ Sbjct: 21 LDDGVLTVTLNRPNSLNSLTAPMLQAFAATLERAAGDPRVRVVRIGGAGRGFCSGAGISE 80 Query: 69 R---NVDPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIVI 125 N GP D+ R +R +A LP+P + V G AAG G +LAL D+VI Sbjct: 81 EDHANPGAAGPPTDVLDGANR----CIRAIANLPQPSVAVVQGAAAGVGVSLALACDVVI 136 Query: 126 AARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMIWQVV 185 A+ A F++AF+K+GL+PD G + L+ GR RAM +ALL ++SA +A++WG++ V Sbjct: 137 ASEKAFFMLAFTKIGLMPDGGASALIAAAVGRIRAMRMALLAERISAREAYDWGLVSSVH 196 Query: 186 DDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGRSADYR 245 E ++ L P L K AIN+A L+ L+ E Q + +SAD+R Sbjct: 197 PAEEFDAEVDKVIATLVAGPAVALRKTKDAINAATLTELEAALERETAGQLVLLKSADFR 256 Query: 246 EGVSAFLAKRSPQFT 260 EG AF +R +FT Sbjct: 257 EGTHAFQQRRVAKFT 271 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 273 Length adjustment: 25 Effective length of query: 237 Effective length of database: 248 Effective search space: 58776 Effective search space used: 58776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory