Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate WP_036377222.1 MVAN_RS29065 aspartate aminotransferase family protein
Query= BRENDA::Q9I6M4 (426 letters) >NCBI__GCF_000015305.1:WP_036377222.1 Length = 465 Score = 229 bits (584), Expect = 1e-64 Identities = 151/422 (35%), Positives = 225/422 (53%), Gaps = 30/422 (7%) Query: 22 QIHPVVAERAENSTVWDVEGREYIDFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQV 81 +I P+ A+ VWD +G + +DF+ + N GH HPKV+AA+ +Q KL Q Sbjct: 45 EISPMTLVAADGCHVWDGQGNKLLDFSSMLVNTNIGHQHPKVVAAIAQQAAKLCTVAPQH 104 Query: 82 LAYEPYIELAEEIAKRVPGDFPKKTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHG 141 A E A IA+R PG+ + G++AVE+AV++AR TGR+ V++ +YHG Sbjct: 105 -ANAARSEAARLIAERTPGEL-NRIFFTNGGADAVEHAVRMARLHTGRSKVLSRYRSYHG 162 Query: 142 RTMMTLGLTGKVVPYSAGMGLMPGGIFRALAP----CELHGVSEDD----SIASIERIFK 193 T + LTG + G GI P + H +E + ++A + + Sbjct: 163 GTDTAINLTGDPRRWPNDHGT--AGIVHFFGPFLYRSQFHAGTEAEESERALAHLHDTIR 220 Query: 194 NDAQPQDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCDQHGILLIADEVQTGAGRTGTFF 253 + P IAAII+E + G G V +M +RALCD++GI+ IADEV G GR+G +F Sbjct: 221 MEG-PNTIAAIILESIPGTAGIMVPPPGYMAGVRALCDEYGIVFIADEVMAGFGRSGKWF 279 Query: 254 ATEQLGIVPDLTTFAKSVGGGF-PISGVAGKAEIMDAIA----PGGLGGTYAGSPIACAA 308 + +VPDL TFAK V G+ P+ GVA I + A PGGL TY+G P+A AA Sbjct: 280 SINHFDVVPDLLTFAKGVNSGYVPLGGVAISPAIAETFAHRAYPGGL--TYSGHPLATAA 337 Query: 309 ALAVLKVFEEEKLLERSQAVG-ERLKAGLREIQAKHKVIGDVRGLGSMVAIELFEGGDTH 367 A+A + E+ ++E + VG E + GLRE+ A+H+ +G+VRG G A+EL T Sbjct: 338 AVATINTMAEDGIVENAARVGAEVIGPGLRELAARHRSVGEVRGAGVFWAVELVADQTTR 397 Query: 368 KPAA------ELVSKIVVRAREKGLILLSCGTYYNVIRFLMPVTIPDAQLEKGLAILAEC 421 +P A ++ ++ ++ GL+ + YN I + P TI D Q +GLAIL + Sbjct: 398 EPLAPYGSSSAAMNSVIAECKKLGLLPFA---NYNRIHVVPPCTITDEQAREGLAILDKA 454 Query: 422 FD 423 D Sbjct: 455 LD 456 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 465 Length adjustment: 32 Effective length of query: 394 Effective length of database: 433 Effective search space: 170602 Effective search space used: 170602 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory