Align Metapyrocatechase; MPC; EC 1.13.11.2; CatO2ase; Catechol 2,3-dioxygenase (uncharacterized)
to candidate WP_037040334.1 BLS63_RS09995 naphthalene 1,2-dioxygenase
Query= curated2:Q53034 (318 letters) >NCBI__GCF_900100495.1:WP_037040334.1 Length = 302 Score = 176 bits (445), Expect = 8e-49 Identities = 106/286 (37%), Positives = 154/286 (53%), Gaps = 9/286 (3%) Query: 4 VTGIGYIGIGVSDLPAWEEFAET-IGFQIRERGEDGTLYLRMDKAHHRVAVHPTGEDDLT 62 V +GY+GI V D AW+ FA +G Q+ + GE YLRMD HHR+ VH G+DDL Sbjct: 7 VIELGYMGISVKDPDAWKSFATNMLGLQVFDEGEKDRFYLRMDYWHHRIVVHHNGQDDLE 66 Query: 63 YVGWQVADENGFDELERTLRAAGVPVEMAGEDDAELRGVARLMRFEDPSGIKSEAYYGLV 122 Y+GW+V+ + F+ L + L AG V + + +A+ R V LM+ DP G +E ++G Sbjct: 67 YLGWRVSGKPEFEALGQKLIDAGYDVRVCDKAEAQERMVLGLMKTVDPGGNPTEIFWGPR 126 Query: 123 SEPEVPY--VSPYAVDFVTEDQGFGHIVVMVDDYDETMRFYREVLGLQTSDLVKVG-AGG 179 + P+ P FVT DQG GH +V D + +FY +LGL+ ++ G Sbjct: 127 IDMSNPFHPGRPLHGKFVTGDQGLGHCIVRQTDVEAAHKFY-SLLGLRGDVEYRIPLPNG 185 Query: 180 VQTRMAFMRCNPRQHSLAFWAGDSTTRLNHFMLQTQTLDQTGMTLDRCFHGGIP-ATNLG 238 + + FM CN R HS+ F A + RLNH ML+ ++ G T + I A LG Sbjct: 186 MTGELTFMHCNGRDHSIGFGAMPAEKRLNHVMLEYTDIEDLGYTHQQFVKNDIDIALQLG 245 Query: 239 RHVNDYAVSFYITTPSGFMIEYGWGVREVVSDYPVDKYRSVSIWGH 284 H ND A++FY TPSG++IE GW + + + +Y I+GH Sbjct: 246 IHANDKALTFYGATPSGWLIEPGWRGAKAIDE---AEYYVGDIFGH 288 Lambda K H 0.320 0.137 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 302 Length adjustment: 27 Effective length of query: 291 Effective length of database: 275 Effective search space: 80025 Effective search space used: 80025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory