Align C4-dicarboxylate TRAP transporter large permease protein DctM (characterized)
to candidate WP_037374533.1 A3GO_RS0101760 C4-dicarboxylate ABC transporter
Query= SwissProt::Q9HU16 (427 letters) >NCBI__GCF_000428045.1:WP_037374533.1 Length = 422 Score = 273 bits (697), Expect = 1e-77 Identities = 153/422 (36%), Positives = 246/422 (58%), Gaps = 15/422 (3%) Query: 8 LLLFLLMFIGVPIAVSLGLSGALTILLF--SPDSVRSLAIKLFETSEHYTLLAIPFFLLS 65 LLL LL +G P+ G+ A +L F S + +AI+ + +E LLAIP F + Sbjct: 6 LLLLLLALLGAPL---FGIIAASALLGFYRSDIDLSVVAIEFYRIAEMPVLLAIPLFTFA 62 Query: 66 GAFMTTGGVARRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGSIAIAG 125 G ++ G RRL+ A +G + GGLA+ +++AC LF A +G+S T+ A+G++ Sbjct: 63 GYLLSESGAPRRLVRLTQALLGWMPGGLALVSLVACALFTAFTGASGVTIVALGALLYPA 122 Query: 126 MVRSGYPQAFGAGIVCNAGTLGILIPPSIVMVVYAA-------ATETSVGKLFIAGVVPG 178 + +SGY F G+V +G+LG+L P++ +++YA A +V +F+AG++PG Sbjct: 123 LTQSGYRDNFSLGLVTTSGSLGLLFAPALPLILYAVIAQQLGIAHNITVDAMFLAGILPG 182 Query: 179 LLLGLILMVVIYIVARVKKLPAMPRVSLREWLASARKALWGLLLMVIILGGIYSGAFTPT 238 LL+ + ++ + + + LP P S E LA+ + A+W L L +++LGGIYSG F + Sbjct: 183 LLM--LSLLAAWSIFSNRSLPLTP-FSASEALAAVKDAIWELPLPIVVLGGIYSGFFAIS 239 Query: 239 EAAAVAAVYSAFVALFVYRDMRLSECPKVLLESGKLTIMLMFIIANAMLFAHVLTTEQIP 298 EAAAV A Y V + + R++ L + P V+ ES L ++ I+ ++ + L +P Sbjct: 240 EAAAVTACYVLLVEVLILREIPLGKLPVVMRESMVLVGGILLILGLSLASTNYLIDAGVP 299 Query: 299 QSIASWVTELGLSPWMFLLVVNIVLLIAGNFMEPSAIILILAPIFFPIAMELGIDPIHLG 358 + + EL FL+++NI LLI G ++ + ++++ P+ PIA+ GIDP+HLG Sbjct: 300 SLLFETIRELVNDKLTFLILLNIFLLILGTMLDIFSALVLMVPLLLPIAIGYGIDPVHLG 359 Query: 359 IIMVVNMEIGLITPPVGLNLFVTSAVTGMPLGATIRAALPWLMILLVFLIIVTYIPAVSL 418 II + NM+IG TPPVG+NLF+ S P+ A LPW +ILL L+++TY P +SL Sbjct: 360 IIFLANMQIGYFTPPVGMNLFIASYRFNKPVLQLYLATLPWFLILLAALLVITYWPWLSL 419 Query: 419 AL 420 AL Sbjct: 420 AL 421 Lambda K H 0.330 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 491 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 422 Length adjustment: 32 Effective length of query: 395 Effective length of database: 390 Effective search space: 154050 Effective search space used: 154050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory