GapMind for catabolism of small carbon sources

 

Alignments for a candidate for epi in Sedimenticola selenatireducens DSM 17993

Align Methylmalonyl-CoA epimerase; DL-methylmalonyl-CoA racemase; EC 5.1.99.1 (characterized)
to candidate WP_037374755.1 A3GO_RS0105820 methylmalonyl-CoA epimerase

Query= SwissProt::O58010
         (136 letters)



>NCBI__GCF_000428045.1:WP_037374755.1
          Length = 145

 Score = 85.9 bits (211), Expect = 2e-22
 Identities = 49/133 (36%), Positives = 80/133 (60%), Gaps = 5/133 (3%)

Query: 6   KRIDHVGIAVKNLEEAIKIWEGLGFKVEEIEEVPDQ--KVKVAVIKVGENRIELLEATTE 63
           K+IDH+ IAVK+L+ A K+WE +  K +  +   D+  +++VA   +G    EL+E+T+ 
Sbjct: 4   KKIDHLCIAVKDLDAARKVWEPILGKSQPDDPYVDEPEQIRVARYWLGGVGFELMESTSP 63

Query: 64  DSPIAKFIEKRGEGIHHLAIRVENIESKLEELKQKGYKLIDEKPRVGA---GGAKIAFIH 120
           D P+AK+IEK GEG+  +++ V +    + EL+ KGY  I  +    A      + AFIH
Sbjct: 64  DGPVAKWIEKHGEGVMIVSLNVADTRESITELEPKGYPFIPTRKGEKARPFRDCEFAFIH 123

Query: 121 PKSVTGVLLELCE 133
           P+ +  VL+EL +
Sbjct: 124 PEKMNNVLVELID 136


Lambda     K      H
   0.317    0.138    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 76
Number of extensions: 6
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 136
Length of database: 145
Length adjustment: 15
Effective length of query: 121
Effective length of database: 130
Effective search space:    15730
Effective search space used:    15730
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 42 (20.8 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory