Align Uncharacterized protein (characterized, see rationale)
to candidate WP_037374757.1 A3GO_RS0106045 (Fe-S)-binding protein
Query= uniprot:E4PLR5 (279 letters) >NCBI__GCF_000428045.1:WP_037374757.1 Length = 260 Score = 281 bits (720), Expect = 8e-81 Identities = 132/254 (51%), Positives = 183/254 (72%), Gaps = 7/254 (2%) Query: 23 RHYPEKPEAVTLFGTCVVDLFFPEAGLDTIRLLEREGVRVHFPQEQSCCGQPAWTSGYRD 82 +HYP++PE V FGTC++DL +P+AGL +RL++REGV+V FPQ+Q+CCGQPAW SGYR+ Sbjct: 5 QHYPDRPEKVYFFGTCLIDLLYPQAGLAGMRLIQREGVQVIFPQDQTCCGQPAWNSGYRN 64 Query: 83 EAKAVARAQLDILDRSGLPVVVPSGSCAGMFRHHYPALFADEPDTLKRVEALAERTFELT 142 E +AV Q+ + P+VVPSGSCAGM RHHYP +F +P+ V ++R FELT Sbjct: 65 ETRAVVLNQIRCFPKD-YPIVVPSGSCAGMMRHHYPEVFKGKPEEAL-VNEFSQRVFELT 122 Query: 143 EFLLKVCRVQLADRGAPSKIALHTSCSARREMNTHLHARELLQQLEGVERIDHDHESECC 202 EFL+ V +++L D G P K+ALHT+CSARREM LL+QL V+ ++ ++ECC Sbjct: 123 EFLVHVLKIELKDLGEPVKVALHTACSARREMGVADEHEALLRQLGNVQLVEQARKAECC 182 Query: 203 GFGGTFSVRMPEVSGAMVKDKTRSLIDSGAVEMVTADGGCLMNINGSLEKQ-----KESF 257 GFGGTF+V+ P++S AMV DK +++ D+GA ++V+ D GCLMNI G +E Q Sbjct: 183 GFGGTFAVKHPDISAAMVADKAQAISDTGADQLVSGDCGCLMNITGHMEHQGIGPRNHHI 242 Query: 258 RGRHLASFLWERTN 271 +G+H+ASFLWERT+ Sbjct: 243 KGQHIASFLWERTH 256 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 260 Length adjustment: 25 Effective length of query: 254 Effective length of database: 235 Effective search space: 59690 Effective search space used: 59690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory