Align fumarylacetoacetate hydrolase (EC 3.7.1.2) (characterized)
to candidate WP_038202191.1 Q392_RS04805 FAA hydrolase family protein
Query= reanno::MR1:200835 (328 letters) >NCBI__GCF_000745855.1:WP_038202191.1 Length = 357 Score = 381 bits (979), Expect = e-110 Identities = 190/332 (57%), Positives = 245/332 (73%), Gaps = 8/332 (2%) Query: 1 MKLASYNNGRRDGQLMLVSRDLTQTVAVPAIAHTMQQLLDGWELLKPQLQELYDALNEGK 60 MKLA+ +G RDGQL++VSRDL+ IAH +QQ+LD W L PQL++L LN G+ Sbjct: 1 MKLATLKDGSRDGQLVVVSRDLSHAHYATGIAHRLQQVLDDWGFLAPQLEDLSTQLNHGR 60 Query: 61 LPNTQTFDETKCLSPLPRAYQWADGSAYVNHVELVRKARGAEMPETFWTDPLFYQGGSDS 120 + FD +C++PLPRAYQWADGSAY+NHVELVRKARGAE+P +F+TDPL YQGGSD Sbjct: 61 ARHAFPFDPAQCMAPLPRAYQWADGSAYLNHVELVRKARGAEVPASFYTDPLMYQGGSDD 120 Query: 121 FIAPKADIPLASEDWGIDFESEIAVITDDVPMGVSAENAAKHIKLLMLVNDVSLRNLIPA 180 F+ P DI + SE GIDFE+EIAV+T DV MG + A ++L+ML NDVSLR+LIPA Sbjct: 121 FLGPCDDIVVPSEAMGIDFEAEIAVVTGDVKMGTGPDEALDAVRLVMLANDVSLRHLIPA 180 Query: 181 ELAKGFGFFQSKPSSSFSPVAITPDELGHRWEDSKVHLPLITYLNGELFGRPNAGVDMTF 240 ELAKGFGFFQSKP+++FSPVA+T DELG WE +VHL L + NG G +AG DM+F Sbjct: 181 ELAKGFGFFQSKPATAFSPVAVTLDELGPAWEQGRVHLALQSTWNGRKVGLTDAGPDMSF 240 Query: 241 NFSQLVSHVAKTRPLGAGAIIGSGTISN--------YDRSAGSSCLAEKRMLEVIADGKA 292 +F QL++H+AKTR + AG+I+GSGT+SN + G +C+AEKR +E I DG+ Sbjct: 241 HFGQLIAHIAKTRNVRAGSIVGSGTVSNPGVEKNGRMEWPKGYACIAEKRSMETILDGEP 300 Query: 293 STPFMRFGDTVRIEMLDDNGVSIFGSIDQKVV 324 T FM+FGDT+RIEM +G S+FG+I+Q+VV Sbjct: 301 KTEFMKFGDTIRIEMKGLDGRSLFGAIEQEVV 332 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 357 Length adjustment: 29 Effective length of query: 299 Effective length of database: 328 Effective search space: 98072 Effective search space used: 98072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory