Align L-rhamnonate dehydratase; RhamD; EC 4.2.1.90 (uncharacterized)
to candidate WP_038205987.1 Q392_RS10335 mandelate racemase/muconate lactonizing enzyme family protein
Query= curated2:A9BQY2 (395 letters) >NCBI__GCF_000745855.1:WP_038205987.1 Length = 401 Score = 103 bits (257), Expect = 9e-27 Identities = 117/385 (30%), Positives = 160/385 (41%), Gaps = 68/385 (17%) Query: 60 LVVEIEDSAGRVGFAVTTGGEPA--AYIVEKHLARFLEGARVTDIERIWDQMYLSTLYYG 117 L V + G VG T G A AY+ E R L GA IE + T Y G Sbjct: 18 LWVRLHTDEGLVGLGETFMGAAAVEAYLHEWAAPRLL-GADPLAIEARARDL---TGYLG 73 Query: 118 RKGIVINTI--SGVDLALWDLLGKVRGEPVHQLLGGAVRDELQFYATGA--------RPD 167 +G + T S VD+ALWDL GK G PV LGGA RD ++ Y T A Sbjct: 74 WRGSGVETRGNSAVDIALWDLFGKAAGMPVCTALGGASRDAIRIYNTCAGYQYVRSTANQ 133 Query: 168 LAQKMGFIGGKMP-------LHHGP----------------------AEGEEG------- 191 + G G P LHH AE G Sbjct: 134 SSSNWGLGNGAGPYEDLQGFLHHADELAESLLSEGITAMKIWPFDLAAEKSHGQYISNAD 193 Query: 192 LRRNLQELATMRERVGPDFWLMLDCWMSLDVNYATRLAQGAQAHGLKWIEEALPPDDYWG 251 L L+ +R VG +M++ + A ++A+ Q W E+A+ D Sbjct: 194 LDAALEPFRKIRGAVGRQMDIMVEFHSLWRLPMAQKIARALQEFDTFWHEDAIRMDSL-- 251 Query: 252 YAALRKN-VPTGMLVTTGEHEATRWGFRQLLEMGCCDIIQPDVGWCGGITELLKISALAD 310 LR+ V LV E A RWGF+ L+ G + D+ WCGG+TE KI+A+AD Sbjct: 252 -DLLRQYAVDCKALVCASETLAYRWGFKDYLQTGVAGVAMLDLSWCGGLTEARKIAAMAD 310 Query: 311 AHQALVIPH---GSSVYSYHFVATRHNSPFAEFLMMAPKADEVVPMFHPQLLGE-PVPVN 366 A Q V PH G V++ A+ H S A ++ ++ +L+ E P+ Sbjct: 311 AWQLPVAPHDCTGPVVWA----ASTHLSLHAPNALVQESVRAFYTGWYKELVTELPIVEQ 366 Query: 367 GRMRLSALDRPGFGVELNPECALHR 391 G +RL+ +PG G+EL P+ LHR Sbjct: 367 GMIRLNG--KPGLGLELLPD--LHR 387 Lambda K H 0.322 0.139 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 395 Length of database: 401 Length adjustment: 31 Effective length of query: 364 Effective length of database: 370 Effective search space: 134680 Effective search space used: 134680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory