Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_038209337.1 Q392_RS15125 3-hydroxyacyl-CoA dehydrogenase
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000745855.1:WP_038209337.1 Length = 252 Score = 301 bits (770), Expect = 1e-86 Identities = 159/255 (62%), Positives = 192/255 (75%), Gaps = 3/255 (1%) Query: 1 MHIANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELGDNARFAVADI 60 M I K FIV+G ASGLG TA+ML AG KV++ D+ EA A+E+G ARF D+ Sbjct: 1 MQIEGKVFIVTGGASGLGEGTARMLAAAGGKVVIADMQIDKGEAVAQEIG--ARFVKCDV 58 Query: 61 SDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFN 120 S E Q+AV AA+S G L GLVNCAGI AEK +GK GPH LA F K + VNL+GSFN Sbjct: 59 SQEADGQAAVAAALS-LGKLVGLVNCAGIAPAEKTVGKNGPHALAVFEKTLRVNLLGSFN 117 Query: 121 LLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELA 180 ++RLAA AMA+ + +GERGV+I+TAS+AAYDGQIGQAAY+ASKG + +TLP AR+LA Sbjct: 118 MIRLAADAMAKNELEPTGERGVLISTASVAAYDGQIGQAAYSASKGGVVGMTLPIARDLA 177 Query: 181 RFGIRVMTIAPGIFETPMMAGMSDEVRASLAAGVPFPPRLGRPQEYAALARHIIENSMLN 240 R GIR MTIAPGIF TPM+ GM EV+ +LAA VPFP RLG P +YA LA+HIIEN MLN Sbjct: 178 RNGIRNMTIAPGIFGTPMLFGMPQEVQDALAASVPFPSRLGTPADYAKLAKHIIENDMLN 237 Query: 241 GEVIRLDGALRMAAK 255 GEVIRLDGA+R+A + Sbjct: 238 GEVIRLDGAIRLAPR 252 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory