Align Gluconolactonase (characterized, see rationale)
to candidate WP_038213216.1 Q392_RS23225 SMP-30/gluconolactonase/LRE family protein
Query= uniprot:A0A165IRV8 (316 letters) >NCBI__GCF_000745855.1:WP_038213216.1 Length = 299 Score = 135 bits (339), Expect = 2e-36 Identities = 102/296 (34%), Positives = 135/296 (45%), Gaps = 26/296 (8%) Query: 35 LGEGVLWSVREQAVYWVDILGRELHRWDPATGAH---QRWTFDEEISAIAERAHAPGFIV 91 LGE W +E+++YW+DI G ++ R GA +RW + +A A G ++ Sbjct: 12 LGESPFWHPQERSLYWLDIAGCQVLRTRGPIGAGVQVERWPLPQAPGCMAP-ARRGGLVI 70 Query: 92 TLRRGF----ALFDPATDMAPRYLHQPEPDRAGNRFNDGKCDAQGRFWAGSMDFACEAPT 147 LR G A P MA D A RFNDGKCD GRFWAGS++ A Sbjct: 71 ALRDGIYRAHAWGGPLARMAAA-----AHDGATMRFNDGKCDPLGRFWAGSINEAKTGRN 125 Query: 148 GALYRYD--SDGSCTRHDDGFAVTNGPTWSGTGQGAAMFFNATIEGNTYR-YDSDLATGT 204 ALY D + G+ G A+T +G GA + +T R Y + Sbjct: 126 AALYCLDPRAAGAALEPKAGDAMTA----NGLAFGAGTLYWTDTPSHTIRAYPWEPEANR 181 Query: 205 VSNKTLWKHW------LPEDGLPDGMTTDAQGRLWIAHWGGWCVTCHDPVTAAELGRVRL 258 + W+ + P G PDG T DAQGR W+A + G V C D L + + Sbjct: 182 LGPPRAWRRFDAKQEGAPYGGRPDGATLDAQGRYWVAMYEGAQVLCLDGAGGGTLAALPV 241 Query: 259 PVSQVTTCAFGGADLRTLFISSARVGLTPEQLAAEPLAGALFAVDTDSLGLPAHPF 314 PV T FGG DLRTLF++SAR G E+LA +P AG + D G P F Sbjct: 242 PVQCPTMPCFGGDDLRTLFVTSARKGRPAEELARQPDAGRVLMQRADEPGRPVDFF 297 Lambda K H 0.321 0.137 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 299 Length adjustment: 27 Effective length of query: 289 Effective length of database: 272 Effective search space: 78608 Effective search space used: 78608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory