Align 3-methyl-2-oxobutanoate dehydrogenase subunit alpha; Branched-chain alpha-ketoacid dehydrogenase E1 component subunit alpha; BCKADH E1-alpha; EC 1.2.4.4 (characterized)
to candidate WP_040689944.1 D471_RS0116495 pyruvate dehydrogenase
Query= SwissProt::P9WIS3 (367 letters) >NCBI__GCF_000341125.1:WP_040689944.1 Length = 370 Score = 290 bits (742), Expect = 4e-83 Identities = 154/348 (44%), Positives = 203/348 (58%), Gaps = 8/348 (2%) Query: 18 EPVQLVGPDGTPTAERRYHRDLPEET-LRWLYEMMVVTRELDTEFVNLQRQGELALYTPC 76 EPV+LV G + + P+ T L L+ MV+ R + + L RQG LA+Y Sbjct: 18 EPVRLVDRHGQRVSHSFF--TAPDHTGLADLHRAMVIGRRFNQQASTLARQGRLAVYPSS 75 Query: 77 RGQEAAQVGAAACLRKTDWLFPQYRELGVYLVRGIPPGHVGVAWRGTWHGGLQFTTKCCA 136 GQEAAQVG L DWLFP YR+ + G+ P +RG WH G CA Sbjct: 76 TGQEAAQVGGVLALGDQDWLFPTYRDSVALVTHGVDPVETLTLFRGDWHAGYDPHRYRCA 135 Query: 137 PMSVPIGTQTLHAVGAAMAAQRLDEDSVTVAFLGDGATSEGDVHEALNFAAVFTTPCVFY 196 P P+ T HAVG AA+R D +A +GDGATSEGD HEA NFAAV+ TP VF Sbjct: 136 PQCTPLATNASHAVGLTYAARRKGRDVAALAIMGDGATSEGDAHEAYNFAAVWNTPVVFL 195 Query: 197 VQNNQWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACYAVMAEAAARARAGDGP 256 VQNN WAIS+P+S QTAAP++AHKA+GYGM G VDGND A YAV++ A A AR+G GP Sbjct: 196 VQNNHWAISVPLSTQTAAPTLAHKAVGYGMRGYHVDGNDAAAVYAVVSHALAEARSGGGP 255 Query: 257 TLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYLQDQGLWSQRLEEQ--- 313 ++EA+TYR+ PHT +D P RYR EV W DP+ R ++ +G+ E + Sbjct: 256 AIVEALTYRVDPHTNSDAPQRYRDDSEVAYWRERDPLTRMAALIRREGVLGDEEETERAL 315 Query: 314 --VTARAKHVRSELRDAVFDAPDFDVDEVFTTVYAEITPGLQAQREQL 359 A A+ V + +RD + + D +F+ VYAE+ P L+ +R++L Sbjct: 316 AAFDAEAEKVATAVRDRMAGEDELDPASLFSDVYAEVPPILREERQEL 363 Lambda K H 0.320 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 370 Length adjustment: 30 Effective length of query: 337 Effective length of database: 340 Effective search space: 114580 Effective search space used: 114580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory