Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_040829257.1 C665_RS13215 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000310185.1:WP_040829257.1 Length = 264 Score = 212 bits (540), Expect = 5e-60 Identities = 114/243 (46%), Positives = 169/243 (69%), Gaps = 6/243 (2%) Query: 2 AEKSNKVLLQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSM 61 A+ N VL +VK L V+YG ++A+ V EG++V++IG NGAGKTT + AI G L Sbjct: 14 ADAKNPVL-EVKDLCVSYGKVEALTDASLTVGEGQIVTVIGPNGAGKTTMLSAIMGVLGS 72 Query: 62 NDGNIEYLGKSIKGKGAWD-LVKEGLVMVPEGRGVFARMTITENLQMGAY--IRKDKAGI 118 G + + G S++G + +V G+ +VPE R +F M++ +NL +GA+ R K Sbjct: 73 R-GQVAFDG-SVEGVPEVERMVARGMTLVPEKRELFGEMSVEDNLVLGAFQRYRMGKRDH 130 Query: 119 LADIEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMV 178 +E+++ +FPRL+ER+ Q AGTMSGGE+QMLA+GRALM++PK+L+LDEPS+GL+P++V Sbjct: 131 AQTLEEVYALFPRLKERRSQAAGTMSGGERQMLAVGRALMAKPKLLMLDEPSLGLAPLIV 190 Query: 179 DKIFEVVRDVYALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPKVRAA 238 +IF ++ ++ GV+I+LVEQNA AL +AD YV+E+G I M GP +L +DP+V A Sbjct: 191 REIFRIISELRRRGVSILLVEQNARAALQVADYAYVLETGQIAMQGPAHELADDPRVIEA 250 Query: 239 YLG 241 YLG Sbjct: 251 YLG 253 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 264 Length adjustment: 24 Effective length of query: 218 Effective length of database: 240 Effective search space: 52320 Effective search space used: 52320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory