Align ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 2 (characterized)
to candidate WP_041096190.1 SUTH_RS00300 amino acid ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4772 (223 letters) >NCBI__GCF_000828635.1:WP_041096190.1 Length = 220 Score = 219 bits (557), Expect = 4e-62 Identities = 115/222 (51%), Positives = 155/222 (69%), Gaps = 6/222 (2%) Query: 2 EFDFSGIIPSLPGLWNGMIMTLKLMAMGVIGGIILGTILALMRLSHNKVLSNIAGAYVNY 61 EFDFS PSLP + +G++ TL+L + + GGI++GT+LAL RLS L+ IAGAYV+ Sbjct: 3 EFDFSVWGPSLPFIRDGLLFTLRLTLVAMTGGIVIGTLLALARLSPIVPLARIAGAYVDL 62 Query: 62 FRSIPLLLVITWFYLAVPFVLRWITGEDTPIGAFASCIVAFMMFEAAYFCEIVRAGVQSI 121 RSIPL+LVI WF+L +PF +TG P+GA S I+ F FEAA++CEI+R+G+QS+ Sbjct: 63 MRSIPLVLVILWFFLVIPF----LTG--APVGAETSAIITFTAFEAAFYCEIMRSGIQSV 116 Query: 122 PKGQMGAAQALGMSYGQMMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYAVGLVDFLNA 181 P+GQ+ AA ALG+ Q M +ILPQA R M P+LL Q+I+LFQDTSLVYA+G D L A Sbjct: 117 PRGQVNAAFALGLGQAQTMIHVILPQAVRNMLPVLLTQTIVLFQDTSLVYAIGAKDMLKA 176 Query: 182 SRASGDIIGRSNEFLIFAGLVYFIISFAASQLVKRLQKRFAV 223 + G R E ++ + L+YF I F+ S VK+LQKR A+ Sbjct: 177 ADVVGKNYNRPVEMIVLSALIYFAICFSLSLAVKQLQKRVAI 218 Lambda K H 0.332 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 220 Length adjustment: 22 Effective length of query: 201 Effective length of database: 198 Effective search space: 39798 Effective search space used: 39798 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory