Align PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate WP_041096191.1 SUTH_RS00305 amino acid ABC transporter permease
Query= TCDB::Q88NY3 (248 letters) >NCBI__GCF_000828635.1:WP_041096191.1 Length = 245 Score = 273 bits (697), Expect = 3e-78 Identities = 129/247 (52%), Positives = 176/247 (71%), Gaps = 2/247 (0%) Query: 1 MNYNWDWGVFFKSTGVGSETYLDWYITGLGWTIAIAITAWIIALLLGSLLGVMRTVPNRL 60 MNY+W++G+F + G ETYLDW ITGLGWT+A+++TAW++AL +G +G +RT P+RL Sbjct: 1 MNYHWNFGIFLEQVKSGDETYLDWLITGLGWTLAVSLTAWLLALCIGIAVGALRTTPSRL 60 Query: 61 VSGIATAYVELFRNVPLLVQLFIWYFLVPDLLPEGLQEWFKQDLNPTTSALISVVICLGL 120 ++ +ATA+VELFRN+PLLVQ+F+W+F+VP+ LP W KQD+ ++ +CLG Sbjct: 61 LALLATAWVELFRNIPLLVQMFLWFFVVPEFLPRDWSLWVKQDM--PAKEFVTAALCLGF 118 Query: 121 FTAARVCEQVRTGIQALPKGQEAAARAMGFSLPQIYNNVLLPQAYRIIIPPLTSEFLNVF 180 FT+ARV EQVR G+ +LP+GQ A+ A+GF+LPQ Y +V+LPQA RI+IPPLTSEF+NVF Sbjct: 119 FTSARVAEQVRAGVGSLPRGQRDASLALGFTLPQTYRHVILPQALRIVIPPLTSEFMNVF 178 Query: 181 KNSSVASLIGLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMGLMLLMRMVEKKVAVP 240 KNSSVA IG++EL Q +Q E S E + TL+YF M +E K VP Sbjct: 179 KNSSVAFAIGVLELTFQARQMQEDSEQGIETYLAVTLLYFICAFAANRGMAWIEAKSRVP 238 Query: 241 GLISVGG 247 GLI+ G Sbjct: 239 GLIARTG 245 Lambda K H 0.325 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 245 Length adjustment: 24 Effective length of query: 224 Effective length of database: 221 Effective search space: 49504 Effective search space used: 49504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory