Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate WP_041096191.1 SUTH_RS00305 amino acid ABC transporter permease
Query= SwissProt::P0AER5 (224 letters) >NCBI__GCF_000828635.1:WP_041096191.1 Length = 245 Score = 108 bits (270), Expect = 9e-29 Identities = 65/215 (30%), Positives = 124/215 (57%), Gaps = 5/215 (2%) Query: 13 LPYLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYVNVFRSIPL-VMV 71 L +L+ GL TL +++TA ++ + G + +R + +A A A+V +FR+IPL V + Sbjct: 22 LDWLITGLGWTLAVSLTAWLLALCIGIAVGALRTTPSRLLALLATAWVELFRNIPLLVQM 81 Query: 72 LLWFYLIVPGFLQNVLGLSPKNDI---RLISAMVAFSMFEAAYYSEIIRAGIQSISRGQS 128 LWF+ +VP FL L K D+ ++A + F +A +E +RAG+ S+ RGQ Sbjct: 82 FLWFF-VVPEFLPRDWSLWVKQDMPAKEFVTAALCLGFFTSARVAEQVRAGVGSLPRGQR 140 Query: 129 SAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFRTASTIG 188 A+LALG T Q+ + +ILPQA R ++P L ++ + +F+++S+ + + + + A + Sbjct: 141 DASLALGFTLPQTYRHVILPQALRIVIPPLTSEFMNVFKNSSVAFAIGVLELTFQARQMQ 200 Query: 189 ERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRT 223 E +E L +YF+ + +A+ +++++ ++ Sbjct: 201 EDSEQGIETYLAVTLLYFICAFAANRGMAWIEAKS 235 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 245 Length adjustment: 23 Effective length of query: 201 Effective length of database: 222 Effective search space: 44622 Effective search space used: 44622 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory