Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate WP_041096231.1 SUTH_RS00445 branched-chain amino acid ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >NCBI__GCF_000828635.1:WP_041096231.1 Length = 295 Score = 170 bits (430), Expect = 4e-47 Identities = 100/310 (32%), Positives = 177/310 (57%), Gaps = 25/310 (8%) Query: 5 IQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQVAPGL 64 +Q I++G +G +YALIALG+ ++Y +NFA GD++M+G +GL+ + V GL Sbjct: 4 LQLIVSGAAIGCIYALIALGFVLIYKATETVNFAQGDLMMIGGFIGLTAMTVA-----GL 58 Query: 65 PGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAMMI-- 122 P + ++ IV + + ER+ RPL P ++ IG+ L + L MI Sbjct: 59 PFALAFLLTIV----AMALFGMGTERLVLRPLLGQPAFTVVMMTIGLGYLARGLVTMIPY 114 Query: 123 WGRSPLPFPQVMPSDPVHIAG---ALISPTQIMLLALAVLAMVGLV-LIVEKTKMGRAMR 178 WG P + + + G L+ + +++ LA +A+V L+ L T++G AM+ Sbjct: 115 WGTETHTLPVPYKDEVIWLGGEGTGLVVSVEHLVIILATVALVALLYLFFRYTRLGIAMQ 174 Query: 179 ATAENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSA 238 AT++N A MG+ +V ++ + + A + +AG++ A + MGFV GLKAF A Sbjct: 175 ATSQNQLAAFYMGIPVRRVNMLIWGLSAAICGVAGLL-LAPITFVHANMGFV-GLKAFPA 232 Query: 239 AVLGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPS 298 AV+GG G+I GA++GG+++G++ES L+G +L ++DI A++V++I+L ++P+ Sbjct: 233 AVVGGFGSIPGALVGGLVIGIVES--------LSGFYLPEGFKDIAAYVVVLIMLVVKPN 284 Query: 299 GIMGERVADR 308 G+ G+ + + Sbjct: 285 GLFGDNLTKK 294 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 295 Length adjustment: 27 Effective length of query: 282 Effective length of database: 268 Effective search space: 75576 Effective search space used: 75576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory