Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_041096236.1 SUTH_RS00460 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_000828635.1:WP_041096236.1 Length = 262 Score = 210 bits (534), Expect = 3e-59 Identities = 110/238 (46%), Positives = 163/238 (68%), Gaps = 5/238 (2%) Query: 5 ILKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHI 64 IL++ + AYG ++A++G+ L+V G +VT++G+NGAGKTT LK I+G L + G + Sbjct: 8 ILQLHNVEAAYGAVKAIRGVSLDVAPGSIVTVLGSNGAGKTTILKTISGILDPQK--GSL 65 Query: 65 EYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYT--SDDKGQIAADIDK 122 + L+G+ +V+ L VPEGR +F ++++ENLLMGAYT + DK +A DI+ Sbjct: 66 LFRSDKLEGRDPAWIVRQGLVHVPEGREIFPLLTVRENLLMGAYTRPASDKDAVAKDIED 125 Query: 123 WFAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEV 182 FA FP LKER Q AG LSGG+QQMLA++RAL++ P ++LLDEPS+GLSP + ++IFE+ Sbjct: 126 VFAYFPILKERQNQPAGQLSGGQQQMLAISRALLAKPTMMLLDEPSLGLSPKLTKEIFEI 185 Query: 183 IRNVSAQ-GITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQMLDDPRVKAAYLG 239 I ++ + G+T+L+VEQNA +AL+ A GYV+E G I M + + +K YLG Sbjct: 186 IVRINRERGVTLLVVEQNAHIALQYADYGYVLEIGRIVMHDTCAALREKDDIKEFYLG 243 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 262 Length adjustment: 24 Effective length of query: 217 Effective length of database: 238 Effective search space: 51646 Effective search space used: 51646 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory