Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_041096491.1 SUTH_RS01365 ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000828635.1:WP_041096491.1 Length = 256 Score = 207 bits (528), Expect = 1e-58 Identities = 111/253 (43%), Positives = 152/253 (60%), Gaps = 1/253 (0%) Query: 1 MSRPILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGG 60 M+ +LE + RFGG+ A+ V+L + ++ +IGPNGAGKTT+FN TG Y GG Sbjct: 1 MTGILLEARNIGKRFGGVQALKDVSLTINTGEIYGLIGPNGAGKTTLFNVFTGLYPRDGG 60 Query: 61 LIRLDGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKT 120 + G + H +A G+ RTFQN+RLF MTA+EN++V +H + +T Sbjct: 61 EVLFAGAPLDLESPHVVAAAGIARTFQNIRLFANMTALENVMVGRHVRTRAGVFGAILRT 120 Query: 121 PAFRRSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEP 180 A R E A L V + + A+ A L YG QRRLEIAR + T P++L LDEP Sbjct: 121 RAERVEEAAIRRRADELLHYVGIADRADDLARNLCYGDQRRLEIARALATDPKLLALDEP 180 Query: 181 AAGLNPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQ 240 AAG+N ET L+ LI LR + +TVLLIEHD+KLVM + D + V++ G +A+ PE Sbjct: 181 AAGMNATETGALRDLIEGLRRD-GLTVLLIEHDVKLVMGLCDRVAVLDYGEKIAEDVPEA 239 Query: 241 IRDNPDVIKAYLG 253 +R NP VI+AYLG Sbjct: 240 VRANPKVIEAYLG 252 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 256 Length adjustment: 24 Effective length of query: 231 Effective length of database: 232 Effective search space: 53592 Effective search space used: 53592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory