Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate WP_041097722.1 SUTH_RS05575 beta-ketothiolase BktB
Query= metacyc::MONOMER-20679 (395 letters) >NCBI__GCF_000828635.1:WP_041097722.1 Length = 395 Score = 236 bits (603), Expect = 7e-67 Identities = 147/406 (36%), Positives = 222/406 (54%), Gaps = 30/406 (7%) Query: 3 EAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAGIDPKEVEDVVMGAAMQQGA 62 E V++S R +G + G+L+ E A L G ++ A+ R+G+DPK V +G + + Sbjct: 6 EVVVLSAVRAAVG-TFMGSLSGMEPADLGGLVVKEAIARSGVDPKAVTFATVGNVIPTES 64 Query: 63 TGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGESIS- 121 +AR A ++ G+ + + ++R C S QA+ +A+++L + A+GGG E +S Sbjct: 65 RYPYVARNATIQGGMTMESVTFAVNRLCGSSQQAVVSSAQAILLGDADFAIGGGVEVMSR 124 Query: 122 -------LVQNDKMNTFHAVDPALEAIK---GDVYMAMLDTAETVAKRYGISRERQDEYS 171 + +M VD + A+ G +M + TAE +AK++ ++RE QDE++ Sbjct: 125 GAYLSPAMRSGARMGDTKMVDAMVAALTDPFGAGHMGI--TAENLAKKHNLTREMQDEFA 182 Query: 172 LESQRRTAAAQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRPETTAEGLA 231 ESQRR AAA G F ++I PI+ K D+ DE + TT E LA Sbjct: 183 CESQRRAAAAVAAGYFKEQIVPITLK----------TRKGDVVFDTDEHIKANTTMESLA 232 Query: 232 GLKAVRGEGFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGC---EPD 288 +K + T+TAGNAS ++DGA+ V+ AAA G KP+ +VSYG + Sbjct: 233 KMKPAFDKAGTVTAGNASGINDGAAFLVLADAAKAAAGGHKPMA---RLVSYGIGGVSHE 289 Query: 289 EMGIGPVFAVPRLLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGIDPEKLNVNGGAISV 348 MG GP+ + L + GL + DIG+ E NEAFA Q L LG+DP+K N NGGAI++ Sbjct: 290 VMGEGPIPSTLIALAKAGLKIADIGVVESNEAFAAQSLTVAKVLGLDPKKTNPNGGAIAI 349 Query: 349 GHPYGMSGARLAGHALIEGRRRKAKYAVVTMCVGGGMGSAGLFEIV 394 GHP G SGA + AL E RR +KY + TMC+GGG G ++E++ Sbjct: 350 GHPIGASGAVIITKALYEARRVGSKYCLATMCIGGGQGITTIWEMI 395 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 395 Length adjustment: 31 Effective length of query: 364 Effective length of database: 364 Effective search space: 132496 Effective search space used: 132496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory