Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_041097908.1 SUTH_RS06110 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_000828635.1:WP_041097908.1 Length = 255 Score = 229 bits (583), Expect = 5e-65 Identities = 116/236 (49%), Positives = 172/236 (72%), Gaps = 5/236 (2%) Query: 1 MLQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRY 60 +L+ + YG+++A+H+V+V +R+GEIVT+IG NGAGK+TLL L G A G +RY Sbjct: 12 LLETSGLCVNYGRVEAIHNVDVRIREGEIVTVIGPNGAGKTTLLSALMGLLPAR-GEVRY 70 Query: 61 MGEELVGQDS-SHIMRKSIAVVPEGRRVFARLTVEENLAMGGFFTDKGDYQEQ---MDKV 116 G+ +G+ S ++ + + +VPE R +F ++V +NL +G F + ++Q MD+V Sbjct: 71 QGQPTLGKMSVDALVARGLVLVPEKRELFGEMSVADNLLLGAFARYRRGERDQAKTMDEV 130 Query: 117 LHLFPRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDII 176 +FPRL ER Q+ GT+SGGE+QMLA+GRALM+KP LL+LDEPSLGLAP+I++++F ++ Sbjct: 131 FAIFPRLAERKAQQAGTLSGGERQMLAMGRALMAKPALLMLDEPSLGLAPLIVREVFRVV 190 Query: 177 EQLRKDGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDPKVREAYLG 232 +QLR+ GV+V LVEQNA AL++AD YVLENG V ++ ++LL DP+V E+YLG Sbjct: 191 QQLREMGVSVLLVEQNARAALQVADYGYVLENGSVAVENDAKSLLGDPRVIESYLG 246 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 255 Length adjustment: 24 Effective length of query: 209 Effective length of database: 231 Effective search space: 48279 Effective search space used: 48279 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory