Align 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase; EC 1.1.1.368 (characterized)
to candidate WP_041098454.1 SUTH_RS08220 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase
Query= SwissProt::O87871 (368 letters) >NCBI__GCF_000828635.1:WP_041098454.1 Length = 359 Score = 308 bits (788), Expect = 2e-88 Identities = 168/354 (47%), Positives = 219/354 (61%), Gaps = 11/354 (3%) Query: 21 WMMTSPGAPMVRAEFEIGELSADQVVVAVAGCGVCHTDLGYYYDSVRTNHALPLALGHEI 80 W MT PG +++ L+A + +V VAGCGVCHTDL Y+Y V T PL+LGHE+ Sbjct: 9 WQMTEPGK-LLKTRIPTPALAAGEALVKVAGCGVCHTDLSYFYMGVPTVQKPPLSLGHEV 67 Query: 81 SGRVVQAG-ANAAQWLGRAVIVPAVMPCGTCELCTSGHGTICRDQVMPGND--IQGGFAS 137 SG VV A + AA+ LG+ VI+PAV+PC CELC +G G C Q MPGN I GG++S Sbjct: 68 SGVVVAAHESTAARVLGKEVIIPAVLPCNKCELCKTGRGNRCLAQKMPGNSMGIYGGYSS 127 Query: 138 HVVVPARGLCPVDEARLAAAGLQLADVSVVADAVTTPYQAVLQAGVEPGDVAVVIGV-GG 196 H+ VPA LC V + L +SVVADAVTTPYQA ++A + GD ++IG GG Sbjct: 128 HIPVPAADLCIVGNR----GNIPLEHLSVVADAVTTPYQAAIRARLTAGDRVIIIGAAGG 183 Query: 197 VGGYAVQIANAFGAS-VVAIDVDPAKLEMMSKHGAALTLNAREISGRDLKKAIEAHAKAN 255 VG + Q+A GA+ V+ ID++ KLE M +GA T+N R + +++K+ +A K Sbjct: 184 VGSFMTQVAKGMGAAAVIGIDINEEKLEFMKGYGADFTINPRGKTAKEVKELFKAFCKEK 243 Query: 256 GLRLTR-WKIFECSGTGAGQTSAYGLLTHGATLAVVGFTMDKVEVRLSNLMAFHARALGN 314 GL WKIFE +G+ GQ A LL+ TL VVG+ D+ LS LMAF A +G Sbjct: 244 GLPSNYGWKIFEVTGSKPGQELALSLLSFTGTLVVVGYGSDETSYMLSKLMAFDAELIGT 303 Query: 315 WGCLPEYYPAALDLVLDKKIDLASFIERHPLDQIGEVFAAAHAHKLTRRAILTP 368 WGCLPEYYP LD+ +D +I L F+E P+ QI +VF AH KL RR ILTP Sbjct: 304 WGCLPEYYPKVLDMCVDGRIALGPFVETRPMSQIEQVFDEAHHGKLKRRVILTP 357 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 21 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 359 Length adjustment: 29 Effective length of query: 339 Effective length of database: 330 Effective search space: 111870 Effective search space used: 111870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory