Align 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase; 6-OCH-CoA hydrolase; 6-oxocyclohex-1-ene-1-carbonyl-CoA hydratase; EC 3.7.1.21 (characterized)
to candidate WP_041098456.1 SUTH_RS08225 6-oxocyclohex-1-ene-1-carbonyl-CoA hydratase
Query= SwissProt::Q2LXU2 (382 letters) >NCBI__GCF_000828635.1:WP_041098456.1 Length = 376 Score = 536 bits (1380), Expect = e-157 Identities = 256/379 (67%), Positives = 305/379 (80%), Gaps = 5/379 (1%) Query: 1 MSLDWMPREHGLKNHSRHTEQWWGTEAPCTVYEKRPLKDPKGNVVPGLYSAWIRLNNPGQ 60 M+L+W+ RE+ LK+H +G +AP +YE+RP+ D KG VPGL+SAWI LNNP Q Sbjct: 1 MALEWLRRENDLKDHQLFDNSHFGKDAPTVIYEERPVLDDKGAAVPGLFSAWIWLNNPSQ 60 Query: 61 YNSYTTEMVKGVIAGFENSSTDREVVAVVFTGTGPNAFCTGGNTKEYSEYYSMRPEEYGS 120 YNSYTT+MVKGVIAG + +S+DR+VVAVVFT G AFCTGGNT EYS YYS RP EYG Sbjct: 61 YNSYTTDMVKGVIAGMQRASSDRKVVAVVFTAVGDKAFCTGGNTAEYSSYYSKRPNEYGE 120 Query: 121 YMELFNNMVDSILMCKKPVICRVNGMRVAGGQEIGTATDITVSSDLAIFGQAGPRHGSAP 180 YM+LFN MVD IL CKKPVICRVNGMRVAGGQEIG ATDITV+SDLA+FGQAGP+HGSAP Sbjct: 121 YMDLFNAMVDGILNCKKPVICRVNGMRVAGGQEIGMATDITVTSDLAVFGQAGPKHGSAP 180 Query: 181 VGGASDFLPWFLSIEDAMWNCVSCEMWSAYKMKAKNLISKALPVLKDDKGNWVRNPQVYT 240 VGG++DFLPWFLS+EDAM+NC+SCE WSAYKMK+K L++KA+PVLK D G WVRNP V T Sbjct: 181 VGGSTDFLPWFLSMEDAMYNCISCETWSAYKMKSKGLVTKAVPVLKKD-GQWVRNPLVRT 239 Query: 241 DTYVKDGEIVYGEPKTGEEAKQARAWVNEKLKNNDYDFSLIDAEVDRIVWVFANLFPGCL 300 DT+V DGEIVYGEP G++ A+A + E DF L+DAEV+R+VW FANLFP CL Sbjct: 240 DTFVDDGEIVYGEPIAGDKVAAAKALMAECTT----DFELLDAEVNRLVWKFANLFPNCL 295 Query: 301 MKSIDGIRQKKKFWWDQIKNDHRYWLGTNMMGEAFLGFGAFNTKKITGKDTIDFIKNRQL 360 + SIDGIR KKKF+WDQ+K +R+WL NM EA+LGF AF+ KK+TGKD IDF++ RQL Sbjct: 296 INSIDGIRGKKKFFWDQMKLPNRHWLAANMNHEAWLGFNAFDAKKVTGKDVIDFVRFRQL 355 Query: 361 IAEGALVDEAFMEQVLGKP 379 +AEGAL D+ F EQVL KP Sbjct: 356 VAEGALFDDKFAEQVLAKP 374 Lambda K H 0.318 0.135 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 571 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 376 Length adjustment: 30 Effective length of query: 352 Effective length of database: 346 Effective search space: 121792 Effective search space used: 121792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory