Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_041099049.1 SUTH_RS10300 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000828635.1:WP_041099049.1 Length = 268 Score = 209 bits (531), Expect = 6e-59 Identities = 109/240 (45%), Positives = 161/240 (67%), Gaps = 7/240 (2%) Query: 9 LLQVKGLKVAYG-GIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNIE 67 +L++ ++V Y +Q ++G+ + G++V+L+GSNGAGKTTT+KA++G L++ DG + Sbjct: 5 VLEINNIEVIYNKAVQVLRGLSLRLPRGQIVALLGSNGAGKTTTLKAVSGLLALEDGEMT 64 Query: 68 YLGKSIKGKGA-----WDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAGILADI 122 + G +LV+ GL V EGR VF +T+ ENL Y + AD Sbjct: 65 RGSVVLDGVDTARLKPHELVRSGLFHVMEGRRVFEDLTVEENLVAATYALTGRRATSADF 124 Query: 123 EKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDKIF 182 + ++ FPRL ERK LAG +SGGEQQMLA+GRAL+++PKV+LLDEPS+GLSP++V+ IF Sbjct: 125 DLVYEYFPRLHERKRGLAGYLSGGEQQMLAIGRALIARPKVMLLDEPSLGLSPLLVENIF 184 Query: 183 EVVRDV-YALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPKVRAAYLG 241 ++ + GV+++LVEQNAS ALA+A GY+ME+G + + GP ++L DP VR YLG Sbjct: 185 TIIARINREQGVSMLLVEQNASVALAVAHTGYIMETGKVVIDGPAEKLAGDPDVREFYLG 244 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 268 Length adjustment: 24 Effective length of query: 218 Effective length of database: 244 Effective search space: 53192 Effective search space used: 53192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory