Align branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized)
to candidate WP_041099055.1 SUTH_RS10315 branched-chain amino acid ABC transporter permease
Query= ecocyc::LIVH-MONOMER (308 letters) >NCBI__GCF_000828635.1:WP_041099055.1 Length = 294 Score = 150 bits (379), Expect = 3e-41 Identities = 95/308 (30%), Positives = 160/308 (51%), Gaps = 14/308 (4%) Query: 1 MSEQFLYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAA 60 MS + + G+ G YAL + + +++ ++N A GE+ M+G+Y F + + Sbjct: 1 MSFDWWMLFEVSLAGIGSGGLYALAGLAFVLIFKATKVVNLAIGEMLMMGAYFFFAMAST 60 Query: 61 LMMMGIDTGWLLVAAGFVGAIVIASAYGWSIERVAYRPVRNSKRLIALISAIGMSIFLQN 120 L GW + G + A++ + A G +ER+ RP+ + + IG+S L Sbjct: 61 L-------GWP-IWLGVLVAVLGSGALGALVERLLIRPMLGESPISVFMITIGLSSILVG 112 Query: 121 YVSLTEGSRDVALPSLFNGQWVVGHSENFSASITTMQAVIWIVTFLAMLALTIFIRYSRM 180 V L G+ + LP V+ I + T L + L +F R+ R Sbjct: 113 AVELIWGADQMRLPDFMPSDPVLIGEAMVPPKIFYG---FLVATSLIAIVLVVF-RFWRG 168 Query: 181 GRACRACAEDLKMASLLGINTDRVIALTFVIGAAMAAVAGVLLGQFYGVINPYIGFMAGM 240 G A RA A D A +GIN RV ++ +V+GA +AA+AG+++G ++P +G G+ Sbjct: 169 GIALRATASDQAAAYSMGINVPRVFSMAWVVGAMVAAIAGIIVGSISS-LSPTMGVF-GL 226 Query: 241 KAFTAAVLGGIGSIPGAMIGGLILGIAEALSSAYLSTEYKDVVSFALLILVLLVMPTGIL 300 ++GG+ S+ GA+IGG+++G+ EA S YL EYK + +F+LL+LVL+V P G+ Sbjct: 227 SVLVVVIVGGLDSVAGALIGGILVGLVEAWSGTYLGGEYKMLATFSLLVLVLMVRPYGLF 286 Query: 301 GRPEVEKV 308 G E+E++ Sbjct: 287 GTHEIERL 294 Lambda K H 0.328 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 294 Length adjustment: 27 Effective length of query: 281 Effective length of database: 267 Effective search space: 75027 Effective search space used: 75027 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory