Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_041099057.1 SUTH_RS10320 ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000828635.1:WP_041099057.1 Length = 274 Score = 235 bits (600), Expect = 6e-67 Identities = 114/253 (45%), Positives = 171/253 (67%), Gaps = 1/253 (0%) Query: 2 SRPILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGL 61 + PILE+ +T+ FGG+ A+NGV+ +V + S+IGPNGAGKT++FN ++GFY+PT G Sbjct: 5 ANPILEIDQVTLAFGGVKALNGVSFEVAPGSITSVIGPNGAGKTSLFNTISGFYRPTAGH 64 Query: 62 IRLDGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTP 121 IR GE+I P + A+ G+ R+FQN+ LF+ MT ++N+ + +H HL+T L LF Sbjct: 65 IRFLGEDITQRPAPQRAKLGLARSFQNIALFRGMTVLDNIKLGRHCHLHTGVLDALFYYG 124 Query: 122 AFRRSE-REAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEP 180 RR E R + ++ + + N L+YG Q+R+E+AR + +P++LMLDEP Sbjct: 125 KARREEVRLRADIEERIIDFLEIDHIRNAPVAALSYGLQKRVEMARALAMQPKVLMLDEP 184 Query: 181 AAGLNPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQ 240 AG+N +ET+D+ I +R E VT+L++EHDM +VM ISDH+VV+N G +ADGTP Sbjct: 185 VAGMNREETEDMARFILDVREEWGVTILMVEHDMGMVMDISDHVVVLNFGEVIADGTPAA 244 Query: 241 IRDNPDVIKAYLG 253 ++ NP+VI+AYLG Sbjct: 245 VQGNPEVIRAYLG 257 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 274 Length adjustment: 25 Effective length of query: 230 Effective length of database: 249 Effective search space: 57270 Effective search space used: 57270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory