Align GluA aka CGL1950, component of Glutamate porter (characterized)
to candidate WP_041099177.1 SUTH_RS10775 ABC transporter ATP-binding protein
Query= TCDB::P48243 (242 letters) >NCBI__GCF_000828635.1:WP_041099177.1 Length = 234 Score = 145 bits (367), Expect = 5e-40 Identities = 85/226 (37%), Positives = 136/226 (60%), Gaps = 12/226 (5%) Query: 1 MIKMTGVQKYF--GD--FHALTDIDLEIPRGQVVVVLGPSGSGKSTLCRTINRLETIEEG 56 +I++ G+++ F GD HALT +D+ + G+ V ++GPSGSGKSTL + L+ + G Sbjct: 3 VIELAGIERVFHLGDSTVHALTHLDVGVEAGEYVAIMGPSGSGKSTLLNLLGLLDRPDAG 62 Query: 57 TIEIDGK----VLPEEGKGLANLRADVGMVFQSFNLFPHLTIKDNVTLAPIKVRKMKKSE 112 + ++G+ + P+E + + R +G VFQSF+L P LT +N+ L P+ + + +E Sbjct: 63 SYHLEGRDVTTLTPDEQAAVRSRR--IGFVFQSFHLVPRLTAAENIGL-PMMLAGIPAAE 119 Query: 113 AEKLAMSLLERVGIANQADKYPAQLSGGQQQRVAIARALAMNPKIMLFDEPTSALDPEMV 172 + L+ G+ +AD P QLSGGQ+QRVAIARA M P ++L DEPT LD Sbjct: 120 RAQRVAQALKDFGLDQRADHRPDQLSGGQRQRVAIARATIMQPAVLLADEPTGNLDRATG 179 Query: 173 NEVLDVMASLAKEGMTMVCVTHEMGFARKAADRVLFMADGLIVEDT 218 ++V+ ++ +L + GMT++ VTH+ +A R L M DG + D+ Sbjct: 180 DDVIHLLEALNERGMTLIIVTHDQKIGSRAR-RQLMMEDGELKSDS 224 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 234 Length adjustment: 23 Effective length of query: 219 Effective length of database: 211 Effective search space: 46209 Effective search space used: 46209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory