Align NADH-dependent phenylglyoxylate dehydrogenase subunit beta; Phenylglyoxylate:NAD oxidoreductase; Phenylglyoxylate:acceptor oxidoreductase; EC 1.2.1.58 (characterized)
to candidate WP_041100324.1 SUTH_RS14790 thiamine pyrophosphate-dependent enzyme
Query= SwissProt::Q8L3A9 (446 letters) >NCBI__GCF_000828635.1:WP_041100324.1 Length = 337 Score = 153 bits (387), Expect = 7e-42 Identities = 108/294 (36%), Positives = 151/294 (51%), Gaps = 19/294 (6%) Query: 158 GLAGCQGCNTELLMRHTLRRVGPDT----VLATPPGCVPGMGSVGFNGTTGTKVPVFHPL 213 G CQGC L R+ + V T + A GC+ + T +VP H L Sbjct: 41 GHRACQGCGEALGARYAIDAVMEATNGRLICANATGCLEVFSTP--YPETSWQVPWIHSL 98 Query: 214 LTNTAAMLAGI------KRQYKRVGRDVQALAIAGDGGASDVGFQSLSGRAERGEQMLFM 267 NTAA+ GI KRQ K RD++ +A GDGG +D+GF LSG ER + +L++ Sbjct: 99 FGNTAAVATGIAAAIKIKRQ-KGERRDIRVVAQGGDGGTTDIGFGCLSGMFERNDDVLYI 157 Query: 268 VVDNEGYMNTGMQRSSCTPYGAWTSTTP-VGETSRGKTQDAKNLPLIMVNHRCAYVATAS 326 DN GYMNTG+QRSS TP A TSTTP VG+ K LP I + H YVATA+ Sbjct: 158 CYDNGGYMNTGVQRSSATPAAARTSTTPAVGDDPGNVFGQGKFLPAIAMAHDIPYVATAT 217 Query: 327 TAYMEDLYDKLDKAIAASKNGFAYLHVYSPCTTAWRFPSNLNMEVARKAVETNFVMLWEY 386 A + DL K+ +A+ G Y+H+ PC W S+ +++AR A ET ++E Sbjct: 218 VADLRDLEAKVRRAMEI--RGARYIHILVPCPLGWGTASHDTIKMARLAKETGIFPVFEA 275 Query: 387 TPQDGLHFTKPVDDPLPVTDYLKAMGRFRHLTPEQ--VEHIQKKVVENQKFVER 438 D + + PLPV +YL+ R+ HL +Q VE I + + + ++R Sbjct: 276 EHGD-IKSVLAIRRPLPVEEYLRPQKRYAHLFGKQPRVEVIAQLQAQADRNIKR 328 Lambda K H 0.320 0.135 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 446 Length of database: 337 Length adjustment: 30 Effective length of query: 416 Effective length of database: 307 Effective search space: 127712 Effective search space used: 127712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory