Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate WP_041100583.1 SUTH_RS15770 glucokinase
Query= curated2:Q7P1R6 (348 letters) >NCBI__GCF_000828635.1:WP_041100583.1 Length = 310 Score = 175 bits (444), Expect = 1e-48 Identities = 103/307 (33%), Positives = 155/307 (50%), Gaps = 11/307 (3%) Query: 12 LLGDVGGSNARFALETAPGVIEDILTLSNERYPTLEDALRDYLAQVGA--RRVAHAAIGI 69 L GD+GG+ L + D ++N + L +LA+ + + + Sbjct: 3 LCGDIGGTKTLLGLFQGDELRVD-RRIANADFQDFASLLASFLAETRTDPSLIRGGCLAV 61 Query: 70 ANPL--NGDLVRMTNCHWSFSIEATRRALGLSTLLLLNDFTALALALPRLPRRELAQVGG 127 A P+ +G R+TN W+ +A GL L L NDF A AL A + Sbjct: 62 AGPIADDGRSARLTNLPWTIDSDALAHDFGLPVLHLANDFAAAALGAVTASSAHKATLQS 121 Query: 128 GAPRPDAPLALIGPGTGLGVSALVPHAGGWRALAGEGGHTSFAPANEREIGIWRYASARF 187 GAP AP ++G GTGLG++ ++P G WR LAGEGGH +FAPA+ + +W + +AR Sbjct: 122 GAPLAAAPRLVVGAGTGLGMAIVLPQDGRWRVLAGEGGHVAFAPADGEQAALWSFLNARH 181 Query: 188 GHVSHERLLSGSGLSLLHRALCALDGAEEAGLAPAEVSARGLSGADARCREALEIFCALL 247 G V+ ER++SG GL+ +H + ++ L P E++ R L D R +L +F A Sbjct: 182 GRVTWERVVSGPGLTSIHAFIAGIE------LPPEEIATRALDDPDTLERRSLNMFLAAY 235 Query: 248 GSAAGNLALTLGARGGVYIGGGIVPRLSGFFEQSPFRRRFEDKGRMSAYLADIPVYLITS 307 G+ AG++AL RGGV++ GGI RL + PF F K +A A +PV+++T Sbjct: 236 GAFAGDMALACLPRGGVFLAGGIAARLLPALQHGPFLAAFNAKAEHAAIAARMPVHVVTD 295 Query: 308 AYPALPG 314 L G Sbjct: 296 PLLGLRG 302 Lambda K H 0.320 0.138 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 310 Length adjustment: 28 Effective length of query: 320 Effective length of database: 282 Effective search space: 90240 Effective search space used: 90240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_041100583.1 SUTH_RS15770 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
../bin/blast/fastacmd -i /tmp/list.10818.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.10818.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.