Align Ornithine aminotransferase; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate WP_041100966.1 SUTH_RS17015 glutamate-1-semialdehyde 2,1-aminomutase
Query= SwissProt::Q6CWC1 (437 letters) >NCBI__GCF_000828635.1:WP_041100966.1 Length = 425 Score = 107 bits (268), Expect = 5e-28 Identities = 87/300 (29%), Positives = 133/300 (44%), Gaps = 21/300 (7%) Query: 30 PVVFSRASGAHVWDPEGKEYLDFLSAYSAVNQGHCHPHIIQALVDQASKLTLSSRAFSND 89 P F+ SGA V D +GKEY+D++ ++ + GH ++A+ + A K LS A + Sbjct: 33 PCFFASGSGARVRDADGKEYIDYVGSWGPLILGHADADTVRAVQEAAMK-GLSFGAPTEA 91 Query: 90 CFASFSKFVTEFFGYESVLPMNTGAEAVESALKLARRWGYMVKKIQPNEAIILGARGNFH 149 V E V +++G EA SA++LAR + I+ G +H Sbjct: 92 EIELAELLVRRVPSMEMVRLVSSGTEATMSAIRLARGF--------TGRDAIIKFEGCYH 143 Query: 150 GRTFGAISLSTDEEDSRMNFG-PFLENVTAKIPGGSDDEFIRYGEIDDYKRAFESHGDKI 208 G SL + FG P V A + + Y + + AF HG I Sbjct: 144 GH---GDSLLVKAGSGLLTFGNPSSAGVPADL--AQHTLVLDYNDAQGLRDAFAKHGKTI 198 Query: 209 CAVIVEPIQGEAGIVVPRADFLTDLQELCKKHQVLLICDEIQTGIARTGKLLCYEHSPNC 268 VIVEP+ G ++ P+ +FL ++ELC +H +LI DE+ TG R G + Sbjct: 199 ACVIVEPVAGNMNLIAPKPEFLAAMRELCTQHGSVLIFDEVMTGF-RVGPGSA-QGLYGI 256 Query: 269 KPDIILLGKAISGGVLPVSCVLSSREIMDCFTPGS---HGSTYGGNPLASRVAIAALEVV 325 PD+ GK + GG +P+ R+IM+ P T GNPL+ + L+ V Sbjct: 257 TPDLSTFGKVVGGG-MPLGAFGGRRDIMEKIAPLGPVYQAGTLSGNPLSVAAGLVTLKKV 315 Lambda K H 0.318 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 437 Length of database: 425 Length adjustment: 32 Effective length of query: 405 Effective length of database: 393 Effective search space: 159165 Effective search space used: 159165 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory