Align Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit; PCC; EC 6.4.1.3; EC 6.3.4.14 (characterized)
to candidate WP_041102493.1 SUTH_RS16605 acetyl-CoA carboxylase biotin carboxylase subunit
Query= SwissProt::I3R7G3 (601 letters) >NCBI__GCF_000828635.1:WP_041102493.1 Length = 454 Score = 456 bits (1173), Expect = e-133 Identities = 229/446 (51%), Positives = 314/446 (70%), Gaps = 4/446 (0%) Query: 1 MFSKVLVANRGEIAVRVMRACEELGVRTVAVYSEADKHGGHVRYADEAYNIGPARAADSY 60 MF KVL+ANRGEIA+R++RAC ELGVRTVAV+SEAD +V+ ADE+ IGPA ++ SY Sbjct: 1 MFGKVLIANRGEIALRILRACRELGVRTVAVHSEADTEAKYVKLADESVCIGPAASSQSY 60 Query: 61 LDHESVIEAARKADADAIHPGYGFLAENAEFARKVEDSEFTWVGPSADAMERLGEKTKAR 120 L+ ++I AA DA+AIHPGYGFL+ENA+FA +VE S F ++GP + + +G+K A+ Sbjct: 61 LNIPAIISAAEVTDAEAIHPGYGFLSENADFAERVEKSGFAFIGPRPETIRLMGDKVSAK 120 Query: 121 SLMQDADVPVVPGTTE--PADSAEDVKAVADDYGYPVAIKAEGGGGGRGLKVVHSEDEVD 178 + M++A VP VPG+ P D E VK + GYPV IKA GGGGGRG++VVH+E + Sbjct: 121 NAMKEAGVPCVPGSDGALPDDPKEIVK-IGRAVGYPVIIKAAGGGGGRGMRVVHTEAALI 179 Query: 179 GQFETAKREGEAYFDNASVYVEKYLEAPRHIEVQILADEHGNVRHLGERDCSLQRRHQKV 238 + E A F+N++VY+EK+LE PRH+E+Q+L+D H N +LGERDCS+QRRHQKV Sbjct: 180 NAVNMTRSEAGAAFNNSTVYMEKFLENPRHVEIQVLSDAHRNSVYLGERDCSMQRRHQKV 239 Query: 239 IEEAPSPALSEDLRERIGEAARRGVRAAEYTNAGTVEFLVEDGEFYFMEVNTRIQVEHTV 298 IEEAP+P ++ + R+G+ R Y AGT EFL E+GEFYF+E+NTR+QVEH V Sbjct: 240 IEEAPAPDINRRVLARVGDRCAEACRRINYRGAGTFEFLYENGEFYFIEMNTRVQVEHPV 299 Query: 299 TEEVTGLDVVKWQLRVAAGEELDFSQDDVEIEGHSMEFRINAEAPEKEFAPATGTLSTYD 358 TE VTG+D+V+ Q+R+AAGE+L F Q D+E+ GH++E RINAE P K F P+ G ++ + Sbjct: 300 TEFVTGIDIVQAQIRIAAGEKLWFKQRDIELRGHAIECRINAEDPFK-FTPSPGKITNWH 358 Query: 359 PPGGIGIRMDDAVRQGDEIGGDYDSMIAKLIVTGSDREEVLVRAERALNEFDIEGLRTVI 418 PPGG GIR+D G + YDSMI K+I G RE+ + R AL+E ++G++T I Sbjct: 359 PPGGPGIRVDSHAYSGYTVPPHYDSMIGKVIAYGDTREQAIRRMRIALSEMMVDGIKTNI 418 Query: 419 PFHRLMLTDEAFREGSHTTKYLDEVL 444 P H+ ++ DE F +G + YL+E L Sbjct: 419 PLHQDLMLDERFIKGGTSIHYLEEKL 444 Lambda K H 0.312 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 635 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 601 Length of database: 454 Length adjustment: 35 Effective length of query: 566 Effective length of database: 419 Effective search space: 237154 Effective search space used: 237154 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory