Align phosphomannose mutase (EC 5.4.2.8) (characterized)
to candidate WP_041223336.1 DET_RS02730 phosphomannomutase
Query= metacyc::MONOMER-13382 (455 letters) >NCBI__GCF_000011905.1:WP_041223336.1 Length = 471 Score = 209 bits (532), Expect = 2e-58 Identities = 149/469 (31%), Positives = 227/469 (48%), Gaps = 27/469 (5%) Query: 5 FGTFGVRGIANEKITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEALISG 64 FGT G RGI + T + A LK + +V+G DTR + + Sbjct: 3 FGTDGWRGIIAKDFTFDNVSVCAQATAAYLKNTSPRNLSLVIGYDTRFASADFARSAAEV 62 Query: 65 LLSVGCDVIDVGI-APTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMGLKKE 123 + + G V PTP + + A G +ITASHNP +NG K+ +G + Sbjct: 63 MAANGIKVYFCSCPTPTPVISHGVVNLKAAGAVIITASHNPARWNGFKVKSADGASAPTQ 122 Query: 124 R----EAIVEELFFKE-----DFDRAKWYEIGEVRREDIIKPYIEAIKSKVDVEAIKKRK 174 EA + +L K DFD A G + D+ Y E I VD+E ++ Sbjct: 123 MITGIEAEIAKLGDKPPVLNLDFDTA--VSRGLIEHVDLAPAYFEKIGGLVDIEKLRDAG 180 Query: 175 PFVVVDTSNGAGSLTLPYLLRELGCKVIT-VNAQPDGYFPAR-NPEPNEENLKEFMEIVK 232 + +D+ +GAG LL + GC + +NA+P+ FP PEP NL + M +VK Sbjct: 181 FNIAIDSMHGAGIGYFKQLL-DGGCNRLNEINAEPNPNFPGMLQPEPITPNLAKLMRLVK 239 Query: 233 ALGADFGVAQDGDADRAVFIDENGRFIQGDKTFALVADAVLKEKG-GGLLVTTVATSNLL 291 + +D G+A DGD+DR +DE G F+ + F+L+A +L+ KG G LV T+ S+++ Sbjct: 240 DIRSDIGLATDGDSDRLGVVDEMGNFLNQLQVFSLLALYMLEVKGLRGPLVKTITNSSMI 299 Query: 292 DDIAKKHGAKVMRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVE 351 D + + + V TKVG V+ + E N IGGEE+GG F HV RD + A ++ Sbjct: 300 DKLGELYNVPVFETKVGFKYVSPVMLEQNALIGGEESGGYAFTGHVPERDAILAGAYFLD 359 Query: 352 IFAKSGKKFSELIDEL-----PKYYQIKTKRHVEGDRHAIV-----NKVAEMARERGYTV 401 +GK +E+++ L P YY E R I+ K A + + + Sbjct: 360 FMITTGKSPAEMLEYLYSKVGPHYYNRVDYTFAEARREEIIKHLTDQKPASLGETKVVST 419 Query: 402 DTTDGAKIIFEDG-WVLVRASGTEPIIRIFSEAKSKEKAQEYLNLGIEL 449 D DG + EDG W+L+R SGTEP++R+++E+ S+ K L G +L Sbjct: 420 DKLDGFRYKLEDGSWLLIRFSGTEPLLRVYAESPSQAKTAALLEDGRQL 468 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 522 Number of extensions: 27 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 471 Length adjustment: 33 Effective length of query: 422 Effective length of database: 438 Effective search space: 184836 Effective search space used: 184836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory