Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate WP_041242954.1 GLOV_RS14360 crotonase
Query= reanno::WCS417:GFF2712 (367 letters) >NCBI__GCF_000020385.1:WP_041242954.1 Length = 254 Score = 108 bits (271), Expect = 1e-28 Identities = 65/185 (35%), Positives = 104/185 (56%), Gaps = 4/185 (2%) Query: 20 LAEVRNHIGHLTLNRPAGLNAITLNMVRRLASQLKAWADDPQVYAVVLRGAGEKAFCAGG 79 + E ++ I +T+NRPA +NA+T+ ++ L+ ++ + V AV++ GAGEKAF AGG Sbjct: 1 MVETKDGIATITVNRPASMNAMTVTTLQELSVVVQELSASAVVRAVIITGAGEKAFIAGG 60 Query: 80 DIRSLYDSFKNGDTLHQDFFVEEYALDLAIHHYRKPVLALMDGFVLGGGMGLVQGADLRV 139 DI L K G ++ + + L AI KP +A ++G+ LGGG L D+R+ Sbjct: 61 DIAMLQ---KLGPVAARELALLAHGLCRAIEQSPKPFIAAVNGYALGGGCELALCCDMRI 117 Query: 140 VTERSRLAMPEVAIGYFPDVGGSYFLPRIPGE-LGIYLGVTGVQIRAADALYCGLADWYL 198 E +R PE+ IG P GGS LPR+ G+ + + +TG I A +A GL + + Sbjct: 118 AAENARFGQPEINIGTLPGFGGSQRLPRLVGKGRALEMILTGDMIDAQEAWRIGLVNKVV 177 Query: 199 ESSKL 203 +++L Sbjct: 178 PAAEL 182 Lambda K H 0.322 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 254 Length adjustment: 27 Effective length of query: 340 Effective length of database: 227 Effective search space: 77180 Effective search space used: 77180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory