Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_041272146.1 DHAF_RS22970 enoyl-CoA hydratase/isomerase family protein
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_000021925.1:WP_041272146.1 Length = 255 Score = 120 bits (300), Expect = 4e-32 Identities = 71/243 (29%), Positives = 122/243 (50%), Gaps = 5/243 (2%) Query: 14 VGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGSEKAFAAGADI----GM 69 + + LN+P+ NA++ +M++L L D D+A+ I++ G + F +G D+ G Sbjct: 14 IATLVLNKPQRRNAIDPGMMEQLAGILESLDQDEAVKVIILKGEGEHFCSGGDLKAGAGT 73 Query: 70 MSTYTYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMMCDIIFAADTAKFG 129 T Y R + ++ + KP+IA V G+A+GGG LA+ CD++ A+++AKF Sbjct: 74 TPTIENSRASLKKYC-RVVQIIQQMEKPVIAMVRGYAVGGGMSLALACDLLMASESAKFS 132 Query: 130 QPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRVIPAASLVDE 189 +K+GI+P G LP+ + +A +L T R ++A EA + G V+ V P A + + Sbjct: 133 SNFLKVGIVPEMGALLFLPQTIGLYRAKELWFTGRVVEAREAWQMGFVNHVFPDAEIEEA 192 Query: 190 AIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQKEGMAAFVE 249 ++ A +A PS + + K N L + E + TE+ K AA Sbjct: 193 TMSLAQGLAGMPSLPMKITKRITNSTINQLLNAVMEAELQSSPFCAQTEEHKAYKAALRN 252 Query: 250 KRK 252 +K Sbjct: 253 NKK 255 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 255 Length adjustment: 24 Effective length of query: 234 Effective length of database: 231 Effective search space: 54054 Effective search space used: 54054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory