Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_041272146.1 DHAF_RS22970 enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_000021925.1:WP_041272146.1 Length = 255 Score = 127 bits (318), Expect = 3e-34 Identities = 71/236 (30%), Positives = 125/236 (52%), Gaps = 2/236 (0%) Query: 10 EKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQDLNDR 69 + G+ TL LN+P+R N+ + M QLA L+ +++D+ ++ ++L G G FC+G DL + Sbjct: 11 DSGIATLVLNKPQRRNAIDPGMMEQLAGILESLDQDEAVKVIILKGEGEHFCSGGDL--K 68 Query: 70 NVDPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIVIAARS 129 T P + + + Y +V+ + ++ KPVI V G A G G +LAL D+++A+ S Sbjct: 69 AGAGTTPTIENSRASLKKYCRVVQIIQQMEKPVIAMVRGYAVGGGMSLALACDLLMASES 128 Query: 130 AKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMIWQVVDDET 189 AKF F K+G++P+ G LP+ G RA L G + A +A + G + V D Sbjct: 129 AKFSSNFLKVGIVPEMGALLFLPQTIGLYRAKELWFTGRVVEAREAWQMGFVNHVFPDAE 188 Query: 190 LADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGRSADYR 245 + + LA+ LA P+ + + K+ NS L+ ++ E ++ +++ Sbjct: 189 IEEATMSLAQGLAGMPSLPMKITKRITNSTINQLLNAVMEAELQSSPFCAQTEEHK 244 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 113 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 255 Length adjustment: 24 Effective length of query: 238 Effective length of database: 231 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory