Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate WP_041306086.1 MVAN_RS09365 NAD(P)-dependent oxidoreductase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >NCBI__GCF_000015305.1:WP_041306086.1 Length = 266 Score = 122 bits (305), Expect = 1e-32 Identities = 85/263 (32%), Positives = 136/263 (51%), Gaps = 23/263 (8%) Query: 10 KIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNYNFWPTDISSASEVHKT 69 K + VTG ASGIG A V LL +GA+V D+ G G+ + D+ + + Sbjct: 8 KGVLVTGAASGIGEATVRRLLDEGASVVGCDLAPGPPSDLPGDIGYLSGDVRDTATAERA 67 Query: 70 VDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQKGVFLMSQA 129 V +I+R GR+DG+V++AGV + L +A +++++++N KG F++ +A Sbjct: 68 VAAVIERTGRLDGVVHSAGVG---------GGGPIHLLPDAEWDRVLDVNLKGTFVVLRA 118 Query: 130 VARQMVKQ-----RSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGKHGIR 184 QM+ Q G IV +SS GLEG+ G S Y A+K + T++ + + G GIR Sbjct: 119 ALAQMITQDRVDGERGAIVTLSSIEGLEGTAGGSAYNASKGGVVLLTKNAAIDYGPSGIR 178 Query: 185 VVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTEVADFVCY 244 V + PG +E TP +E + +E R+G ++ L R GR EVA + Sbjct: 179 VNAICPGFIE-----TPLFESVIGIP---GMEGPRDGL-RHEHKLRRFGRPEEVAAVAAF 229 Query: 245 LLSERASYMTGVTTNIAGGKTRG 267 L+S A++++G + GG T G Sbjct: 230 LVSSDAAFVSGQAIAVDGGYTAG 252 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 266 Length adjustment: 25 Effective length of query: 242 Effective length of database: 241 Effective search space: 58322 Effective search space used: 58322 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory